DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and K09E4.1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_496952.1 Gene:K09E4.1 / 175067 WormBaseID:WBGene00010719 Length:367 Species:Caenorhabditis elegans


Alignment Length:192 Identity:47/192 - (24%)
Similarity:84/192 - (43%) Gaps:37/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTRHRLHLIDF 156
            ||:||..|.|.| :|::.|...||:.:::.:...|.|.|:.|::...:|..... :|| |.:.| 
 Worm   139 GPTLEQCFAMRN-KFTLGTAGRLAEDVLNVIRCAHKHGYLVRNMDLNSFHYDAA-SRH-LFMAD- 199

  Fly   157 GLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCK---VQSRRDDLESVGYVLIYLLRGSLP 218
             :|....::..:...|.   ..:||...||.     |.   :...|.|||:..|.|::|:.|.||
 Worm   200 -ISSLVKNISGDDGAPI---ASYAGCLDYAP-----CSDDGLVGARQDLETWFYQLVHLVLGELP 255

  Fly   219 WQGL------LPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNY--IIYTRQLGFEEEPDY 272
            |..|      :..::.||::...|:             |..|:..  ::..::....||.:|
 Worm   256 WGSLSREEAGVKKAEFQKSKEFAEL-------------PEVFHKIAEVVIAKEYSVVEEEEY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 44/177 (25%)
STKc_CK1 17..279 CDD:270918 47/192 (24%)
K09E4.1NP_496952.1 PKc_like <132..291 CDD:304357 44/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.