DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Y39G8C.2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_496946.1 Gene:Y39G8C.2 / 175061 WormBaseID:WBGene00012731 Length:276 Species:Caenorhabditis elegans


Alignment Length:232 Identity:78/232 - (33%)
Similarity:119/232 - (51%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSN 80
            :|.|.||.|.||.:|..|...:....|:|||:|...:.|..::..:..|...|.|...| |....
 Worm    25 VVSRLLGEGGFGAVYLVKDTKTNKTFAMKVEQKMEKRKHSKLKMEIAILKLVGAGKHFT-QIVDR 88

  Fly    81 RRHD-----VLVMELLGPSLETLFT-MCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPEN 139
            .:.|     .|||||:|.||..|.. ...|.||..|.|.:|.|.::.:|.||...::|||:||:|
 Worm    89 GKKDKEGYFFLVMELVGKSLGDLKNERAERVFSFGTGLGVASQCLEAVEDLHRTGFIHRDLKPQN 153

  Fly   140 FLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSR---RDD 201
            :..|:...||.::::|||::::|.:.|.....| |....:.||.|:|   .|.|...:.   |||
 Worm   154 YACGLDEKRHNIYILDFGIARKYLNTKNELKTP-REAVGFKGTVRFA---PLACHRFTELGPRDD 214

  Fly   202 LESVGYVLIYLL--RGSLPWQGLLPNSKLQKAEMILE 236
            .||..|:|:.|:  || |||:.:     .:|.|::.|
 Worm   215 CESWFYLLLDLILPRG-LPWRKM-----NEKGEVLKE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 78/232 (34%)
STKc_CK1 17..279 CDD:270918 78/231 (34%)
Y39G8C.2NP_496946.1 PKc_like 23..276 CDD:389743 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.