DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk-1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_492694.1 Gene:csnk-1 / 172891 WormBaseID:WBGene00013709 Length:407 Species:Caenorhabditis elegans


Alignment Length:293 Identity:129/293 - (44%)
Similarity:180/293 - (61%) Gaps:3/293 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            :|:|.|:||::...|::.:..|||:|:|...:....|.:|...|.||....|:|..:.|....::
 Worm    32 KKIGCGNFGELRLGKNLYNNEHVAIKLEPMKSKAPQLHLEYRFYKLLGQAEGLPQVHYFGPCGKY 96

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            :.|||||||.|||.||.:|:|.||:|||.|:|.|::.|:||:|..|.::||:||||||:|...||
 Worm    97 NALVMELLGHSLEDLFDLCDRHFSLKTVAMVAMQLIRRIEYVHTKHLIYRDVKPENFLIGRYSTR 161

  Fly   149 --HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211
              |.||:|||||:|.|.|....:|:..|......|||||.|:|....|.||||||||::|::.:|
 Worm   162 KQHVLHIIDFGLAKEYIDCDTGKHIAYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMY 226

  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            .||||||||||..::..::.:.|.:.|..|....||.|:|:||..|:.|.|:|.|.|.|||....
 Worm   227 FLRGSLPWQGLKADTLKERYQKIGDTKRQTAVEVLCEGFPDEFAQYLRYARRLDFFETPDYDFCY 291

  Fly   277 CTFLSLLFNLKFTNDLIYDWDHAEKN-SGKSGS 308
            ..|.|:|..|..|.|..:||.....| |..|||
 Worm   292 NLFKSVLDRLGATYDYEFDWTPKLNNVSTPSGS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 108/241 (45%)
STKc_CK1 17..279 CDD:270918 116/261 (44%)
csnk-1NP_492694.1 STKc_CK1_gamma 27..314 CDD:271028 124/281 (44%)
SPS1 27..>249 CDD:223589 98/216 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.