DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and Y65B4A.9

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001293249.1 Gene:Y65B4A.9 / 171658 WormBaseID:WBGene00022032 Length:391 Species:Caenorhabditis elegans


Alignment Length:301 Identity:90/301 - (29%)
Similarity:140/301 - (46%) Gaps:54/301 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSN- 80
            |.:.|.:|:||.||:.|....|...|:|.|..|...|.|...|.|...:.|      ...||:| 
 Worm    23 VTKPLATGTFGSIYKVKRESDGKFFAVKCEALNMKSSLLRQMSVVLASIHH------PSPFFTNI 81

  Fly    81 -------RRHDVLVMELLGPSLETLFTMCN--RRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIK 136
                   .|...:||.|.|.:|..|....|  |:|||.|.|.||:|.:..:..||.:.::|||||
 Worm    82 EERGTVPNRFLFIVMPLYGENLYELMMNTNKDRKFSMATGLHLAEQTLAAIRDLHRNGFIHRDIK 146

  Fly   137 PENFLMG--VGLTRHRLHLIDFGLSKRYWDMKENRHVPQ---RRGTKWAGTARYASVNALCCKVQ 196
            |.:|.:|  :....|:::|:||||.||...:|:|....:   :....:.|..:||||:|...|..
 Worm   147 PSHFCIGREIDGQHHQVYLLDFGLCKRPRFVKKNDEAEEQMRKNAIHYRGVVKYASVHAHQGKNL 211

  Fly   197 SRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLS---------TLPNSLCAGY-- 250
            ..:||:||..|:::....|:|||  .|.|.:.::..:.|:.:::         |.|.: .||:  
 Worm   212 GYKDDMESWWYMVLEFFLGALPW--ALLNKESEQDVLHLKRRITAPMVASVWRTTPET-TAGFFD 273

  Fly   251 -------PNEFYNYIIYTR-----QLGFE-------EEPDY 272
                   |.:...::.|.|     |..||       |.||:
 Worm   274 LLTIIREPKDVAEFVEYDRIADGIQKLFEKSKSNTQEPPDW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 82/274 (30%)
STKc_CK1 17..279 CDD:270918 90/301 (30%)
Y65B4A.9NP_001293249.1 STKc_TTBK 20..302 CDD:270919 85/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.