DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and TTBK2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005254228.1 Gene:TTBK2 / 146057 HGNCID:19141 Length:1250 Species:Homo sapiens


Alignment Length:235 Identity:69/235 - (29%)
Similarity:119/235 - (50%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NRRHDVLVMELLGPSLETLFTMCNR-RFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMG 143
            |.|.:.:||:|.|.:|..|....:| .|::.|.|.|..|:::.:|.:|...::||||||.||.||
Human    92 NDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAMG 156

  Fly   144 -VGLTRHRLHLIDFGLSKRY----WDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
             ...|..:.:::||||::::    .|::     |.|....:.||.||||:||...:...|.|||.
Human   157 RFPSTCRKCYMLDFGLARQFTNSCGDVR-----PPRAVAGFRGTVRYASINAHRNREMGRHDDLW 216

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:.|:|:..:.|.|||:      |::..|.:..:|.......:....|.||..::.:...|.:..
Human   217 SLFYMLVEFVVGQLPWR------KIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDYFT 275

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGS 308
            :|||:::...|.:.:..........:||:    .:|..||
Human   276 KPDYQLLTSVFDNSIKTFGVIESDPFDWE----KTGNDGS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 59/184 (32%)
STKc_CK1 17..279 CDD:270918 63/204 (31%)
TTBK2XP_005254228.1 PKc_like 75..287 CDD:304357 63/205 (31%)
SPS1 78..>267 CDD:223589 59/185 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.