DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CSNK1G3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_016864546.1 Gene:CSNK1G3 / 1456 HGNCID:2456 Length:481 Species:Homo sapiens


Alignment Length:305 Identity:119/305 - (39%)
Similarity:177/305 - (58%) Gaps:27/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDI-------------------------YEAKHMGSGLHVALKVERKNAGQSHLSIE 58
            :|:|.|:||::                         .:.|::.:..:||:|:|...:....|.:|
Human    47 KKIGCGNFGELRLDQREKPEGCQGTSASLICDFRLCAQGKNLYTNEYVAIKLEPMKSRAPQLHLE 111

  Fly    59 STVYNLLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLE 123
            ...|..|..|.|||..|.|....:::.:|:||||||||.||.:|:|.||:|||||:|.|::.|:|
Human   112 YRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRME 176

  Fly   124 YLHLHHYVHRDIKPENFLMG--VGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYA 186
            |:|..:.::||:||||||:|  ...|:..:|:|||||:|.|.|.:..:|:|.|......|||||.
Human   177 YVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYM 241

  Fly   187 SVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYP 251
            |:|....|.||||||||::|::.:|.||||||||||..::..::.:.|.:.|.:|....||..:|
Human   242 SINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP 306

  Fly   252 NEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW 296
            .|...|:.|.|:|.|.|:|||..:|..|..|.....:..|..|||
Human   307 EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDW 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 104/266 (39%)
STKc_CK1 17..279 CDD:270918 113/286 (40%)
CSNK1G3XP_016864546.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.