DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CSNK1G2

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_005259555.1 Gene:CSNK1G2 / 1455 HGNCID:2455 Length:445 Species:Homo sapiens


Alignment Length:310 Identity:120/310 - (38%)
Similarity:176/310 - (56%) Gaps:32/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVE--RKNAGQSHL-------------------------- 55
            :|:|.|:||::...|::.:..:||:|:|  :..|.|.||                          
Human    50 KKIGCGNFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSATGTGRPAGGAGAAQGQ 114

  Fly    56 --SIESTVYNLLRHGMGIPMTYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQM 118
              ....|...|.....|:|..|.|....:::.:|:||||||||.||.:|:|.|::|||||:|.|:
Human   115 GGGCRRTPVRLSSAAEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQL 179

  Fly   119 VDRLEYLHLHHYVHRDIKPENFLMGVGLTR--HRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAG 181
            :.|:||:|....::||:||||||:|...|:  |.:|:|||||:|.|.|.:..:|:|.|......|
Human   180 ITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTG 244

  Fly   182 TARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSL 246
            ||||.|:|....|.||||||||::|::.:|.||||||||||..::..::.:.|.:.|.:|....|
Human   245 TARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVL 309

  Fly   247 CAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW 296
            |..:|.|...|:.|.|:|.|.|:|||..:|..|..|.....|..|..|||
Human   310 CENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDW 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 104/271 (38%)
STKc_CK1 17..279 CDD:270918 113/291 (39%)
CSNK1G2XP_005259555.1 SPS1 45..398 CDD:223589 120/310 (39%)
STKc_CK1_gamma 45..362 CDD:271028 120/310 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.