DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CSNK1E

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001885.1 Gene:CSNK1E / 1454 HGNCID:2453 Length:416 Species:Homo sapiens


Alignment Length:304 Identity:143/304 - (47%)
Similarity:203/304 - (66%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LRI-NSIMVIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPM 73
            ||: |...:.||:|||||||||...::.||..||:|:|........|.|||..|.:::.|:|||.
Human     3 LRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPS 67

  Fly    74 TYQFFSNRRHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPE 138
            .....:...::|:||||||||||.||..|:|:||:||||:|||||:.|:||:|..:::|||:||:
Human    68 IKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPD 132

  Fly   139 NFLMGVGLTRHRLHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLE 203
            |||||:|...:.:::|||||:|:|.|.:.::|:|.|......|||||||:|......||||||||
Human   133 NFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197

  Fly   204 SVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEE 268
            |:||||:|...||||||||...:|.||.|.|.|.|:||....||.|||:||..|:.:.|.|.|::
Human   198 SLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDD 262

  Fly   269 EPDYRMIRCTFLSLLFNLKFTNDLIYDWDHAEKNSGKSGSEEDR 312
            :|||..:|..|.:|.....|:.|.::||:..:..:.::..:.||
Human   263 KPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 125/242 (52%)
STKc_CK1 17..279 CDD:270918 132/261 (51%)
CSNK1ENP_001885.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 134/273 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..416 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.