DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and CSNK1A1

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001020276.1 Gene:CSNK1A1 / 1452 HGNCID:2451 Length:365 Species:Homo sapiens


Alignment Length:341 Identity:153/341 - (44%)
Similarity:202/341 - (59%) Gaps:47/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIRKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNR 81
            ::||:|||||||||.|.::.:|..||:|:|.:.|....|..||.:|.:|:.|:|||....:...:
Human    19 LVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIRWYGQEK 83

  Fly    82 RHDVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGL 146
            .::||||:|||||||.||..|:|||:|||||||||||:.|:||:|..:::||||||:|||||:| 
Human    84 DYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIG- 147

  Fly   147 TRH------------------------------RLHLIDFGLSKRYWDMKENRHVPQRRGTKWAG 181
             ||                              :|.||||||:|:|.|.:..:|:|.|......|
Human   148 -RHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQHIPYREDKNLTG 211

  Fly   182 TARYASVNALCCKVQSRRDDLESVGYVLIYLLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSL 246
            ||||||:||.....||||||:||:||||:|..|.|||||||...:|.||.|.|.|.|:||....|
Human   212 TARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVL 276

  Fly   247 CAGYPNEFYNYIIYTRQLGFEEEPDYRMIRCTFLSLLFNLKFTNDLIYDW--------DHAEKNS 303
            |.|:|.||..|:.|.|.|.|||.|||..:|..|..|...|....|..:||        ..|..:|
Human   277 CKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSS 341

  Fly   304 GK-------SGSEEDR 312
            |:       :|.:.|:
Human   342 GQGQQAQTPTGKQTDK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 132/271 (49%)
STKc_CK1 17..279 CDD:270918 142/291 (49%)
CSNK1A1NP_001020276.1 STKc_CK1_alpha 16..309 CDD:271030 142/291 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.