DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9962 and csnk1g3

DIOPT Version :9

Sequence 1:NP_608697.1 Gene:CG9962 / 33448 FlyBaseID:FBgn0031441 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_012813598.1 Gene:csnk1g3 / 100038034 XenbaseID:XB-GENE-479074 Length:456 Species:Xenopus tropicalis


Alignment Length:280 Identity:117/280 - (41%)
Similarity:177/280 - (63%) Gaps:2/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RKLGSGSFGDIYEAKHMGSGLHVALKVERKNAGQSHLSIESTVYNLLRHGMGIPMTYQFFSNRRH 83
            :|:|.|:||::...|::.:..:||:|:|...:....|.:|...|..|..|.|:|..|.|....::
 Frog    47 KKIGCGNFGELRLGKNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGVPQVYYFGPCGKY 111

  Fly    84 DVLVMELLGPSLETLFTMCNRRFSMKTVLMLADQMVDRLEYLHLHHYVHRDIKPENFLMGVGLTR 148
            :.:|:||||||||.||.:|:|.||:|||||:|.|::.|:||:|..:.::||:||||||:|....:
 Frog   112 NAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNK 176

  Fly   149 HR--LHLIDFGLSKRYWDMKENRHVPQRRGTKWAGTARYASVNALCCKVQSRRDDLESVGYVLIY 211
            ::  :|:|||||:|.|.|.:..:|:|.|......|||||.|:|....|.||||||||::|::.:|
 Frog   177 NQQIIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMY 241

  Fly   212 LLRGSLPWQGLLPNSKLQKAEMILEMKLSTLPNSLCAGYPNEFYNYIIYTRQLGFEEEPDYRMIR 276
            .||||||||||..::..::.:.|.:.|.:|....||..:|.|...|:.|.|:|.|.|:|||..:|
 Frog   242 FLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKPDYDYLR 306

  Fly   277 CTFLSLLFNLKFTNDLIYDW 296
            ..|..|.....:..|..|||
 Frog   307 KLFTDLFDRKGYMFDYEYDW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9962NP_608697.1 SPS1 16..>259 CDD:223589 102/241 (42%)
STKc_CK1 17..279 CDD:270918 111/261 (43%)
csnk1g3XP_012813598.1 STKc_CK1_gamma 42..329 CDD:271028 117/280 (42%)
CK1gamma_C 329..407 CDD:372217
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D281034at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.