DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15395 and mei-38

DIOPT Version :9

Sequence 1:NP_608696.3 Gene:CG15395 / 33447 FlyBaseID:FBgn0031440 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001334676.1 Gene:mei-38 / 31104 FlyBaseID:FBgn0260986 Length:347 Species:Drosophila melanogaster


Alignment Length:319 Identity:91/319 - (28%)
Similarity:142/319 - (44%) Gaps:106/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GDLGVESMESFASAISEEF---PRLQQH-------REQVEQL------------QRRGRQIV--- 50
            |||..||.:....|..:..   |:::.|       :.::::|            |...:|||   
  Fly    75 GDLKKESPKDTTEASKDALTIKPKVEPHDVPELKLKTELQELAQVSPLDNGPEPQDDIKQIVPLN 139

  Fly    51 ------------SQAQQHSQVLVSNLFKNMKISCEKPT----------FPPQ------------V 81
                        ::|.||   ||..         |:|.          .||:            .
  Fly   140 WGKDGDDDEKHMTEADQH---LVHQ---------ERPPGVGAKLRLEWSPPRHREHEGAGASATS 192

  Fly    82 SAPKAYRFKDIYSSRKDQLIRECREQERKQREFHSRPMPDFRQAHSRQSSRVVVHRITCPTTPNV 146
            :|||||:|||:|.|::.|.:|:..|:|.|.|:|||||||:|:..|.|.:...|:|:||.|.||..
  Fly   193 AAPKAYQFKDVYESKRQQAMRKRSEEESKARQFHSRPMPNFKAMHKRMNELAVIHKITVPRTPET 257

  Fly   147 LKNSREMEEKRRLRVEQLQRERELESQLHKMQAPRAKPIPQSSRQPLKSSNRPSSAVPAARVKVE 211
            ||:|:...|:||                      ...|..|:...|..:.:|             
  Fly   258 LKHSQSNVERRR----------------------DDDPADQARLHPAGTRSR------------- 287

  Fly   212 PFNLSAESRVQQRRIFNIQTSKAQEARRRELEDQRQRAEREAYQKLRQRTTFRARPNPF 270
            ||:|.:|.||:.||.|:.....:.|.:::|.::||:|.|:|..::||:.|.|:||||||
  Fly   288 PFHLRSEQRVRDRREFDAAVQVSLEQKKKEQDEQRKRCEQEEIKELRKMTAFKARPNPF 346



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA4T
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016770
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.