DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drp1 and DRP4A

DIOPT Version :9

Sequence 1:NP_001259946.1 Gene:Drp1 / 33445 FlyBaseID:FBgn0026479 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_176253.1 Gene:DRP4A / 842348 AraportID:AT1G60530 Length:301 Species:Arabidopsis thaliana


Alignment Length:281 Identity:107/281 - (38%)
Similarity:160/281 - (56%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIPVINKLQDVFNTVGSDSIQLPQIVVLGSQSSGKSSVIESVVGRSFLPRGTGIVTRRPLVLQLI 68
            |:..:::|:::  .|..:.||||.|||:|.||||||||:||:.|.: ||||.||.||.|||::| 
plant    43 LLDTVDRLRNL--NVMREGIQLPTIVVVGDQSSGKSSVLESLAGIN-LPRGQGICTRVPLVMRL- 103

  Fly    69 YSPLDDRENRSAENGTSNAEEWGRFLHTKKCFTDFDEIRKEIENETERAAGSNKGICPEPINLKI 133
                    .||:   :...|.|..: ..|...||.:.:.:.|...|:..||:.:|:...|:.|.:
plant   104 --------QRSS---SPEPEIWLEY-SDKVVPTDEEHVAEAICAATDVIAGTGEGVSDTPLTLSV 156

  Fly   134 FSTHVVNLTLVDLPGITKVPVGDQPEDIEAQIKELVLKYIENPNSIILAVTAANTDMATSEALKL 198
            ...:|.:||:|||||||:|||..|||:|..||..:::||||...||||.|.:|..|..|.|::::
plant   157 KKNNVPDLTMVDLPGITRVPVNGQPENIYEQISRMIMKYIEPQESIILNVLSATVDFTTCESIRM 221

  Fly   199 AKDVDPDGRRTLAVVTKLDLMDAG----TDAIDILCGRVIPVKLGIIGVMNRSQKDIMDQKHIDD 259
            ::.||..|.||||||||.|:...|    ..|.|:..|      ||.|.|.||..::..::..:.:
plant   222 SRQVDKTGERTLAVVTKADMAPEGLLQKVTADDVSIG------LGYICVRNRIGEETYEEARVQE 280

  Fly   260 QMKDEAAFLQRKYPTLATRNG 280
            .:      |.|.:|.|:..:|
plant   281 DL------LFRTHPLLSLIDG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drp1NP_001259946.1 DLP_1 23..301 CDD:206738 104/262 (40%)
CrfC 88..728 CDD:223771 71/197 (36%)
Dynamin_M 226..507 CDD:279383 13/55 (24%)
GED 643..729 CDD:280391
DRP4ANP_176253.1 DLP_1 60..300 CDD:206738 104/262 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.