DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and ARC15

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_012202.1 Gene:ARC15 / 854748 SGDID:S000001324 Length:154 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:38/148 - (25%)
Similarity:65/148 - (43%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FRKIDVDQYNEDNFR---------EDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLRC 65
            :|:||:|.::.::.|         .:..|......|..:::.:|.|.|.|:.| :..|...|...
Yeast     5 WRRIDIDAFDPESGRLTAADLVPPYETTVTLQELQPRMNQLRSLATSGDSLGA-VQLLTTDPPYS 68

  Fly    66 KNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIP-SEGSSGHLLQWH 129
            .:...|:......|..|..::...:...|..|..:.. |||:||:|:|..:| .:...|.||.|.
Yeast    69 ADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQR-DVLVKYLYKGMSVPQGQKQGGVLLAWL 132

  Fly   130 EKAFAKGGVGCIVRVLSD 147
            |:.....||..||..:||
Yeast   133 ERITQVSGVTPIVHYISD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 36/146 (25%)
ARC15NP_012202.1 P16-Arc 4..152 CDD:398396 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346199
Domainoid 1 1.000 49 1.000 Domainoid score I2949
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I1855
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - oto100083
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - LDO PTHR12644
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R91
SonicParanoid 1 1.000 - - X1402
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.