DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and CRK

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_567216.1 Gene:CRK / 828087 AraportID:AT4G01710 Length:132 Species:Arabidopsis thaliana


Alignment Length:128 Identity:45/128 - (35%)
Similarity:71/128 - (55%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FREDDGVESAAAGPD--ESEITTLLTQGKSVEALLSALQNAPLRCKNQNVKDHALNITLRVLLSI 85
            |.|.|..|:..|..:  ..:|.:||.|.|.||||.:||:.:|.:.:::..|.....:..|.|::|
plant     4 FVEADNAEAIIARIETKSRKIESLLKQYKHVEALKTALEGSPPKTRDERCKSANWIVVHRALMAI 68

  Fly    86 KSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWHEKAFAKGGVGCIVRVLSDT 148
            |  .:|..::.||. :..|:||||:|||.......:....|:.|||...:.|:|||:|.|:||
plant    69 K--DIDGMLNALDV-EYYDILMKYLYRGLSTGDRPTCDQCLKIHEKLTERAGLGCILRCLTDT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 43/125 (34%)
CRKNP_567216.1 P16-Arc 3..127 CDD:398396 43/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I3402
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2460
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm3317
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - LDO PTHR12644
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.