DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and Arpc5l

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_083085.1 Gene:Arpc5l / 74192 MGIID:1921442 Length:153 Species:Mus musculus


Alignment Length:150 Identity:76/150 - (50%)
Similarity:110/150 - (73%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAAA----GPDESEITTLLTQGKSVEALLSALQNA 61
            ||:||.|:.||::|:|:::|:.| .|:..|:|||    |||..|:..||.||..:.|..:||:|:
Mouse     1 MARNTLSSRFRRVDIDEFDENKF-VDEHEEAAAAAGEPGPDPCEVDGLLRQGDMLRAFHAALRNS 64

  Fly    62 PLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLL 126
            |:..|||.||:.|..:.|:||.:.||::::||:.:||:|. ||:||||||:|||.|:|.||..||
Mouse    65 PINTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNG-IDLLMKYIYKGFEKPTENSSAVLL 128

  Fly   127 QWHEKAFAKGGVGCIVRVLS 146
            ||||||.|.||:|.|:|||:
Mouse   129 QWHEKALAVGGLGSIIRVLT 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 71/141 (50%)
Arpc5lNP_083085.1 P16-Arc 9..151 CDD:398396 71/141 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831513
Domainoid 1 1.000 147 1.000 Domainoid score I4488
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4318
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm43971
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - LDO PTHR12644
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R91
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.