DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and arpc5l

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001039197.1 Gene:arpc5l / 734053 XenbaseID:XB-GENE-490524 Length:152 Species:Xenopus tropicalis


Alignment Length:148 Identity:79/148 - (53%)
Similarity:106/148 - (71%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAA--AGPDESEITTLLTQGKSVEALLSALQNAPL 63
            |||||.|:.|||:|:|:|:|:.|.:|...|..|  .||||:|:.:|:.||..:.|..|||:|:|:
 Frog     1 MAKNTLSSRFRKVDIDEYDENKFVDDQLQEEPAEPQGPDEAEVDSLIRQGDLLRAFQSALRNSPV 65

  Fly    64 RCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQW 128
            ..|||.||:....|.|:||.|.||..:::|::|||.|. ||:||||||:|||.|:|.||..||||
 Frog    66 NSKNQVVKERTQAIVLKVLTSFKSNDIEKAVNTLDPNG-IDLLMKYIYKGFEKPTENSSAILLQW 129

  Fly   129 HEKAFAKGGVGCIVRVLS 146
            ||||...||:|.|||||:
 Frog   130 HEKALVIGGLGSIVRVLT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 73/140 (52%)
arpc5lNP_001039197.1 P16-Arc 10..149 CDD:368064 73/139 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4681
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4257
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm49146
Panther 1 1.100 - - LDO PTHR12644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.