DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and arpc5

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001017242.1 Gene:arpc5 / 549996 XenbaseID:XB-GENE-494089 Length:150 Species:Xenopus tropicalis


Alignment Length:146 Identity:73/146 - (50%)
Similarity:105/146 - (71%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLRC 65
            |||||.|..|||:|||:|:|:.|.:::.......||||.|:.:.:..|..:.||.:||:|.|:..
 Frog     1 MAKNTVSARFRKVDVDEYDENKFVDEEEAGEGQQGPDEGEVDSAIRGGNMMGALQAALKNPPINT 65

  Fly    66 KNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWHE 130
            |||:.||.|.::.|:||:|.|:..:::|:.:||:|:: |:||||||:|||.||:.||..||||||
 Frog    66 KNQSAKDRAEHLVLKVLISFKANDIEKAVQSLDKNNM-DLLMKYIYKGFESPSDNSSAVLLQWHE 129

  Fly   131 KAFAKGGVGCIVRVLS 146
            ||.|..|||.|||||:
 Frog   130 KALAVAGVGSIVRVLT 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 67/138 (49%)
arpc5NP_001017242.1 P16-Arc 10..147 CDD:368064 67/137 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4681
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4176
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm49146
Panther 1 1.100 - - O PTHR12644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.030

Return to query results.
Submit another query.