DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and arpc5b

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_958917.1 Gene:arpc5b / 399482 ZFINID:ZDB-GENE-040120-7 Length:150 Species:Danio rerio


Alignment Length:147 Identity:81/147 - (55%)
Similarity:111/147 - (75%) Gaps:3/147 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNAFRKIDVDQYNEDNF-REDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLR 64
            |:|||.|:.|||:|||:|:|:.| .|::|.|: ..||||:|:.:|:.||..:.||.:.|:|.|:.
Zfish     1 MSKNTVSDRFRKVDVDEYDENKFVDEEEGGEN-QLGPDEAEVDSLIRQGNLMGALQAVLKNPPIN 64

  Fly    65 CKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWH 129
            .|||||||.|..:.|:||.|.|||.:::.:.:||:|. :|:||||||:|||.|||.||..|||||
Zfish    65 TKNQNVKDRAEGLVLKVLSSFKSTDIEKGVQSLDKNG-VDLLMKYIYKGFERPSENSSAVLLQWH 128

  Fly   130 EKAFAKGGVGCIVRVLS 146
            |||.:.||||||||||:
Zfish   129 EKALSAGGVGCIVRVLT 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 76/139 (55%)
arpc5bNP_958917.1 P16-Arc 9..148 CDD:309715 76/139 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574541
Domainoid 1 1.000 151 1.000 Domainoid score I4311
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4176
Inparanoid 1 1.050 160 1.000 Inparanoid score I4212
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm25711
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - O PTHR12644
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R91
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.