DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and Arpc5

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001020888.1 Gene:Arpc5 / 360854 RGDID:1311791 Length:151 Species:Rattus norvegicus


Alignment Length:147 Identity:78/147 - (53%)
Similarity:108/147 - (73%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNA-FRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLR 64
            |:|||.|:| |||:|||:|:|:.|.:::......|||||.|:.:.|.||....||.:||:|.|:.
  Rat     1 MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN 65

  Fly    65 CKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWH 129
            .|:|.|||.|.:|.|:||:|.|:..:::|:.:||:|. :|:||||||:|||.||:.||..|||||
  Rat    66 TKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNG-VDLLMKYIYKGFESPSDNSSAMLLQWH 129

  Fly   130 EKAFAKGGVGCIVRVLS 146
            |||.|.||||.|||||:
  Rat   130 EKALAAGGVGSIVRVLT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 73/139 (53%)
Arpc5NP_001020888.1 P16-Arc 10..149 CDD:398396 72/137 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..44 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335251
Domainoid 1 1.000 147 1.000 Domainoid score I4388
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4176
Inparanoid 1 1.050 154 1.000 Inparanoid score I4234
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm46061
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - O PTHR12644
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.