DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and arx-7

DIOPT Version :9

Sequence 1:NP_001259945.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001379803.1 Gene:arx-7 / 171882 WormBaseID:WBGene00000205 Length:152 Species:Caenorhabditis elegans


Alignment Length:152 Identity:55/152 - (36%)
Similarity:91/152 - (59%) Gaps:3/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNAFRKIDVDQYNEDNFRE-DDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLR 64
            |:||..:.::||:|||.::.:.:.| |:.|::...||||..:...|:..:..:||.:||.:.||:
 Worm     1 MSKNMQNTSYRKLDVDSFDPEQYDENDETVDTPGLGPDERAVQGFLSSNRLEDALHAALLSPPLK 65

  Fly    65 CKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGS-SGHLLQW 128
            .|:|||||.|..:..:||.|.|:.:::..:..|...: .|:||||:|:..||.::.: ...||.|
 Worm    66 TKDQNVKDRATQLVTKVLQSFKNAEIEATVQKLSIEE-SDILMKYVYKSMEIGADAAVCQSLLAW 129

  Fly   129 HEKAFAKGGVGCIVRVLSDTNR 150
            |.:..||.|.|.|:||.|...|
 Worm   130 HAQLVAKFGHGAIMRVFSGRQR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_001259945.1 P16-Arc 9..147 CDD:282544 50/139 (36%)
arx-7NP_001379803.1 P16-Arc 9..150 CDD:398396 51/141 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166560
Domainoid 1 1.000 96 1.000 Domainoid score I4601
eggNOG 1 0.900 - - E1_KOG3380
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4176
Inparanoid 1 1.050 103 1.000 Inparanoid score I3537
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55328
OrthoDB 1 1.010 - - D1565115at2759
OrthoFinder 1 1.000 - - FOG0001504
OrthoInspector 1 1.000 - - otm14458
orthoMCL 1 0.900 - - OOG6_102485
Panther 1 1.100 - - LDO PTHR12644
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R91
SonicParanoid 1 1.000 - - X1402
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.