DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arpc5 and ARPC5

DIOPT Version :10

Sequence 1:NP_608693.1 Gene:Arpc5 / 33444 FlyBaseID:FBgn0031437 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001257368.1 Gene:ARPC5 / 10092 HGNCID:708 Length:154 Species:Homo sapiens


Alignment Length:150 Identity:77/150 - (51%)
Similarity:107/150 - (71%) Gaps:5/150 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKNTSSNA-FRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQ---GKSVEALLSALQNA 61
            |:|||.|:| |||:|||:|:|:.|.:::......|||||.|:.:.|..   |....||.:||:|.
Human     1 MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNP 65

  Fly    62 PLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLL 126
            |:..|:|.|||.|.:|.|:||:|.|:..:::|:.:||:|. :|:||||||:|||.||:.||..||
Human    66 PINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNG-VDLLMKYIYKGFESPSDNSSAMLL 129

  Fly   127 QWHEKAFAKGGVGCIVRVLS 146
            ||||||.|.||||.|||||:
Human   130 QWHEKALAAGGVGSIVRVLT 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arpc5NP_608693.1 P16-Arc 9..147 CDD:461399 72/141 (51%)
ARPC5NP_001257368.1 P16-Arc 10..152 CDD:461399 71/140 (51%)

Return to query results.
Submit another query.