DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B17.2 and Ndufa12

DIOPT Version :9

Sequence 1:NP_001137770.1 Gene:ND-B17.2 / 33443 FlyBaseID:FBgn0031436 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_079827.3 Gene:Ndufa12 / 66414 MGIID:1913664 Length:145 Species:Mus musculus


Alignment Length:132 Identity:58/132 - (43%)
Similarity:78/132 - (59%) Gaps:13/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QMVREAGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYFENPYYFYGRNRWIEFAPHVN-----MD 74
            |.|...|||:......:|.:|::||||||.|||||||:|:...|:||:||:.:...:|     .|
Mouse    12 QQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWD 76

  Fly    75 YDGSMIPAEWYGWMHYKTDLPPIRDGCRP----KYKWIADHSENLSGTKEAYYPYSTTPNKVEAW 135
            .||||:|.||:.|:|..||.||..:   |    |:.| .:|..|:|.|.|.|.|||||..|:..|
Mouse    77 VDGSMVPPEWHRWLHCMTDDPPTTN---PPTARKFIW-TNHKFNVSATPEQYVPYSTTRKKIHEW 137

  Fly   136 EP 137
            .|
Mouse   138 VP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B17.2NP_001137770.1 NDUFA12 40..135 CDD:282872 47/103 (46%)
Ndufa12NP_079827.3 NDUFA12 37..116 CDD:398650 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833321
Domainoid 1 1.000 102 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10314
Inparanoid 1 1.050 115 1.000 Inparanoid score I4817
Isobase 1 0.950 - 0 Normalized mean entropy S5712
OMA 1 1.010 - - QHG55931
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006276
OrthoInspector 1 1.000 - - oto93306
orthoMCL 1 0.900 - - OOG6_103702
Panther 1 1.100 - - LDO PTHR12910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10342
SonicParanoid 1 1.000 - - X4563
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.