DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B17.2 and Ndufa12

DIOPT Version :9

Sequence 1:NP_001137770.1 Gene:ND-B17.2 / 33443 FlyBaseID:FBgn0031436 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001100251.2 Gene:Ndufa12 / 299739 RGDID:1311462 Length:145 Species:Rattus norvegicus


Alignment Length:137 Identity:58/137 - (42%)
Similarity:81/137 - (59%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTKLFQMVREAGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYFENPYYFYGRNRWIEFAPHVN-- 72
            |.:..|.|...|||:......:|.:|:::|||||.|||||||:|:...|:||:||:.:...:|  
  Rat     7 LKRGLQQVTGHGGLRGLLRVFFRANDIRLGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGK 71

  Fly    73 ---MDYDGSMIPAEWYGWMHYKTDLPPIRDGCRP----KYKWIADHSENLSGTKEAYYPYSTTPN 130
               .|.||||:|.||:.|:|..||.||.   .:|    |:.| .:|..|:|.|.|.|.|||||..
  Rat    72 NTFWDVDGSMVPPEWHRWLHCMTDDPPT---TKPLTARKFIW-TNHKFNVSATPEQYVPYSTTRK 132

  Fly   131 KVEAWEP 137
            |::.|.|
  Rat   133 KIQEWVP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B17.2NP_001137770.1 NDUFA12 40..135 CDD:282872 47/103 (46%)
Ndufa12NP_001100251.2 NDUFA12 37..137 CDD:282872 47/103 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336875
Domainoid 1 1.000 102 1.000 Domainoid score I6704
eggNOG 1 0.900 - - E1_KOG3382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10314
Inparanoid 1 1.050 115 1.000 Inparanoid score I4738
OMA 1 1.010 - - QHG55931
OrthoDB 1 1.010 - - D1475919at2759
OrthoFinder 1 1.000 - - FOG0006276
OrthoInspector 1 1.000 - - oto96848
orthoMCL 1 0.900 - - OOG6_103702
Panther 1 1.100 - - LDO PTHR12910
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4563
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.