DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B17.2 and Y116A8C.30

DIOPT Version :10

Sequence 1:NP_608692.1 Gene:ND-B17.2 / 33443 FlyBaseID:FBgn0031436 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001255924.1 Gene:Y116A8C.30 / 178485 WormBaseID:WBGene00013807 Length:151 Species:Caenorhabditis elegans


Alignment Length:75 Identity:17/75 - (22%)
Similarity:26/75 - (34%) Gaps:16/75 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYFENPYYFYGRNRWIEFAPHVNMDYDGSMIPA-- 82
            |.|...:.|..|...|......|..|..||:::|     ...:|     .:|:..:|.....|  
 Worm     6 AWGRVASNLWKYVRGDFSKKNYVAEDGSGNRFYE-----ISNSR-----QNVSRGFDPPSSGAQQ 60

  Fly    83 ----EWYGWM 88
                ||..|:
 Worm    61 EPDLEWQAWL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B17.2NP_608692.1 NDUFA12 40..135 CDD:461542 12/55 (22%)
Y116A8C.30NP_001255924.1 None

Return to query results.
Submit another query.