DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B17.2 and Y94H6A.8

DIOPT Version :9

Sequence 1:NP_001137770.1 Gene:ND-B17.2 / 33443 FlyBaseID:FBgn0031436 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_500247.2 Gene:Y94H6A.8 / 177056 WormBaseID:WBGene00022380 Length:146 Species:Caenorhabditis elegans


Alignment Length:145 Identity:63/145 - (43%)
Similarity:87/145 - (60%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLGINRLTKLFQMVREAGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYFENPYYFYGRNRWIEFA 68
            :|||:::.|..|||:|.||:|....|.|..|..::|||||.|.:||:|:||..||..||||:||.
 Worm     6 WLGIDKIQKFGQMVKEIGGVKAVLKKRYLMDATRVGTLVGSDNFGNRYYENNAYFVPRNRWVEFP 70

  Fly    69 PHVNMDYDGSMIPAEWYGWMHYKTD-----LPPIRDGCRPKYKWIADHSENLS-GTKEAYYPYST 127
            ..|.:|||.:.:|.||:.|:|:.||     .||      |...|:.:|.||.| ...:.|.||||
 Worm    71 DKVWLDYDATQVPPEWHSWLHHITDDAPSVKPP------PTQDWVLEHKENTSIYADKKYVPYST 129

  Fly   128 TPNKVEAWEPKAKKQ 142
            |..|::.|:|..|.|
 Worm   130 TRTKIQGWQPGEKPQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B17.2NP_001137770.1 NDUFA12 40..135 CDD:282872 44/100 (44%)
Y94H6A.8NP_500247.2 NDUFA12 42..137 CDD:282872 44/100 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157493
Domainoid 1 1.000 105 1.000 Domainoid score I4169
eggNOG 1 0.900 - - E1_KOG3382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10314
Inparanoid 1 1.050 134 1.000 Inparanoid score I3154
Isobase 1 0.950 - 0 Normalized mean entropy S5712
OMA 1 1.010 - - QHG55931
OrthoDB 1 1.010 - - D1475919at2759
OrthoFinder 1 1.000 - - FOG0006276
OrthoInspector 1 1.000 - - oto19308
orthoMCL 1 0.900 - - OOG6_103702
Panther 1 1.100 - - LDO PTHR12910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10342
SonicParanoid 1 1.000 - - X4563
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.