DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Elba2 and insv

DIOPT Version :9

Sequence 1:NP_608691.1 Gene:Elba2 / 33442 FlyBaseID:FBgn0031435 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001285566.1 Gene:insv / 33441 FlyBaseID:FBgn0031434 Length:376 Species:Drosophila melanogaster


Alignment Length:342 Identity:85/342 - (24%)
Similarity:146/342 - (42%) Gaps:43/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 RLLSRPIMKQEEMDIEN--------YINYEVAAQQTMMRQ------RTLKPLGQLQIQMP--PPI 118
            |.:|.|   ..::::||        |:..::...:.::.|      |..:....|....|  ||.
  Fly    42 RSISAP---DPQVEVENRALRDKVRYLEAKLQQHKDLLSQIHATSARMQQASSLLAESRPPTPPA 103

  Fly   119 IVNQPVKPVPVKAVPVRRSSPPKRRVINAQLVAVATASGGIKNIEPRVEPLPRLEESFKQQVAKI 183
            :.:..:...|...:.....:|   ::::.::::....:..|: |....|.|..|..|......:|
  Fly   104 VQSHHILTPPSSEICAPAQNP---QILDYKIISAPDDADAIE-IRLAAESLNSLSTSADSDRLEI 164

  Fly   184 -------QKSQHHYEQLFGRLTSMLKTLNQRYDNDAE--DVPAPPSKRPRHMSTSSSES------ 233
                   |:|.||..|...|:::.:|.     |..:|  |.|....||.:.......|.      
  Fly   165 CLGDENHQQSNHHNSQQQYRISNGIKR-----DGSSESADTPLQFIKRRKLQEIQLQEEIPRQNI 224

  Fly   234 HIPDTASEKDEKDTLVQYPHRVQKEDGSAVYVLGPNGTQITAHQYGEVFWTNAPVATRCLLCVVF 298
            .:|.....|....:........|:...:.:..:|||.|.:.|..:..:.|:...:|||.||..:|
  Fly   225 KLPAKPQVKARNGSFTDLNKGQQQNMDNVMVSIGPNNTCVPASVFENINWSVCSLATRKLLVTIF 289

  Fly   299 SSDELATHTLTGKPSPAFYGRERPPKLQLDQRKVDDIVVCVRNRTGGKERVIRATITTKCADTAK 363
            ..:.||||::||||||||..:::|.|..||..|:.||:..|.::....|:.:|..|||||||..|
  Fly   290 DRETLATHSMTGKPSPAFKDQDKPLKRMLDPGKIQDIIFAVTHKCNASEKEVRNAITTKCADENK 354

  Fly   364 KYKRRAKKAQKVAIKEE 380
            ..|.:..|.:...||.|
  Fly   355 MMKIQNVKRRSSGIKHE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Elba2NP_608691.1 BEN 289..358 CDD:287493 31/68 (46%)
insvNP_001285566.1 BEN 278..356 CDD:214981 36/77 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I16928
eggNOG 1 0.900 - - E1_2CVGF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012708
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.