DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment insv and Bsg25A

DIOPT Version :9

Sequence 1:NP_001285566.1 Gene:insv / 33441 FlyBaseID:FBgn0031434 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523472.2 Gene:Bsg25A / 33669 FlyBaseID:FBgn0000227 Length:363 Species:Drosophila melanogaster


Alignment Length:218 Identity:82/218 - (37%)
Similarity:123/218 - (56%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DENHQQSNHHNSQQQYRISNGIK--RDGSSE-SADTPLQFIKRRKLQEIQLQEE----IP----- 220
            :..|:|| |...|.|.:.|....  |||:.| :..||     :...:::.|.::    :|     
  Fly   158 EPEHKQS-HEQDQDQEQSSEPFNAFRDGADEHNTSTP-----KTNDEDLGLDDDDEDYVPGGEET 216

  Fly   221 ----RQNIKLP--AKPQVKARNGSFT-DLNKGQQQNMDNVMVSIGPNNTCVPASVFENINWSVCS 278
                |:.||.|  :.|..|.|...|. ||:.      ::.||:||||.|.|.......|||.:..
  Fly   217 MGNKRKRIKKPVTSTPNAKRRCPGFEFDLDG------ESPMVTIGPNGTEVSRISLSAINWDMTG 275

  Fly   279 LA-TRKLLVTIFDRETLATHSMTGKPSPAFKDQDKPLKRMLDPGKIQDIIFAVTHKCNASEKEVR 342
            .: |||||..||||:|||.|:::|||||||:|..:|.|:.|||.|:.|:::.:|:..:.:.:|||
  Fly   276 PSITRKLLCEIFDRDTLAHHTLSGKPSPAFRDCARPSKQQLDPLKVADLVYLMTNSLDMTPREVR 340

  Fly   343 NAITTKCADENKMMKIQNVKRRS 365
            .||||||||||||:: ..::|:|
  Fly   341 TAITTKCADENKMLR-SRMQRKS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
insvNP_001285566.1 BEN 278..356 CDD:214981 43/78 (55%)
Bsg25ANP_523472.2 BEN 279..354 CDD:214981 43/74 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444664
Domainoid 1 1.000 66 1.000 Domainoid score I16928
eggNOG 1 0.900 - - E1_2CVGF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012708
OrthoInspector 1 1.000 - - otm49726
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.