DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad1 and RAD17

DIOPT Version :9

Sequence 1:NP_477440.1 Gene:Rad1 / 33440 FlyBaseID:FBgn0026778 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_015013.1 Gene:RAD17 / 854550 SGDID:S000005895 Length:401 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:58/275 - (21%)
Similarity:98/275 - (35%) Gaps:68/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KFVA---RVEHIKTFIQAIKSICFNDYGMVQVSEDGLRITVEQGKSIQATLFMPPGAFMEF---- 70
            ||.|   .:|||.|.:..:......|..::.:..|||....|....|:..|.:....||.:    
Yeast    10 KFSASTVHLEHITTALSCLTPFGSKDDVLIFIDADGLSFVRENNHVIKIQLLLSRELFMSYSYRN 74

  Fly    71 RVQDFQCFGVKMNVLSECLSLFGS-----ADCSLRMMYRDKGDPLKIILYPHDDDDVSTECAIKT 130
            ..:|.....||:|.:.:.:|:...     .:|:|  .|...|.|..:|.   :|..:|       
Yeast    75 ETEDHMKLCVKINHILDSVSVMNRNSDDIVECTL--SYDGHGSPFVLIF---EDSFIS------- 127

  Fly   131 MDCDEPIDYDQNL-KDPDLNVIFVRGPNLSKVFNELEKSAEEFEFVTSPNRPHFKITTVGIMQAV 194
                |.::|...| ||.|.|.:            ||::....||.:......|..:..       
Yeast   128 ----ERVEYSTYLIKDFDTNGL------------ELDRERISFEAIIKGEALHSALKD------- 169

  Fly   195 FSVEVAKTSPMMMMFNCKQT-VVARYKSQQ---IRMTNKAMQSATKVAIKTNSVGLLELHLVMQG 255
                       :....||:. |.|:.::..   ..:.:|:....:|:.:.:|. .:||...|..|
Yeast   170 -----------LKEIGCKECYVYAKTEANDENVFALISKSQLGFSKIKLPSNR-SILEKLQVFDG 222

  Fly   256 DSQEEI----FIQFF 266
            ||...|    .|.||
Yeast   223 DSTTVIDGFAVIGFF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad1NP_477440.1 PCNA 13..272 CDD:238322 58/275 (21%)
Rad1 13..253 CDD:280331 50/256 (20%)
RAD17NP_015013.1 Rad1 11..271 CDD:396631 57/274 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346443
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004120
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103936
Panther 1 1.100 - - LDO PTHR10870
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1057
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.