DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad1 and AT4G17760

DIOPT Version :9

Sequence 1:NP_477440.1 Gene:Rad1 / 33440 FlyBaseID:FBgn0026778 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_193511.2 Gene:AT4G17760 / 827497 AraportID:AT4G17760 Length:300 Species:Arabidopsis thaliana


Alignment Length:302 Identity:64/302 - (21%)
Similarity:129/302 - (42%) Gaps:51/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEP-SPYGDCKFVARVEHIKTFIQAIKSICFNDY--GMVQVSEDGLRITVEQGKSIQATLFMPPG 65
            :|| :|    ..:.::::::..:.|:..:.:..:  .:|::||.|:.:.||:...:||.:::...
plant     9 IEPDTP----DLICQLDNVQGMVDALTCVRWKRHQDALVELSEHGIVLIVEESGCLQAKVYLQRE 69

  Fly    66 AF--MEFRVQDFQCFGVKMNVLSECLSLFGSADCSLRMMYRDKGDPLKIILYPHDDDDVSTECAI 128
            .|  .|:..|....||:.:.:|.:||:.|.|...|..:..:..|..::::|...|..:......|
plant    70 LFTKYEYGAQGRPRFGISLGLLVDCLNTFSSPGHSNTIEIKYPGPDMELLLKSVDTLNSCIYSEI 134

  Fly   129 KTMDCDEPIDYDQNLKDPDLN--VIFVRGPNLSKVFNELE--KSAEEFEFVTSPNRPHFKITTVG 189
            :|. ..|.:.:|.|.:...:.  ...|:...|.:..::||  .|:.:......|....|:....|
plant   135 RTR-IPETVTWDYNFEQAGIAPLTFTVKSAALKEAIDDLEWPGSSVQISLQKEPPCVIFRGEGHG 198

  Fly   190 IMQAVFSVEVAKTSPMMMMFNCKQTVVARYKSQQIRMTNKAMQSATKVAIKTNSV---------- 244
            .:|..| :..|.|. :::.|:|...|...||.:.::        ||...|..|.|          
plant   199 DLQIDF-MYYANTD-LLLAFHCDTEVSYGYKYKFLK--------ATTANIPGNVVRENRGSKLTI 253

  Fly   245 ---GLLEL-HLVMQGDS---QEE----------IFIQFFIIP 269
               |:|:: |||....:   |.|          .:|:||:.|
plant   254 GRGGMLKVQHLVSVSKALAPQVESAGYQPPSRIAYIEFFVKP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad1NP_477440.1 PCNA 13..272 CDD:238322 61/292 (21%)
Rad1 13..253 CDD:280331 54/261 (21%)
AT4G17760NP_193511.2 PCNA 17..276 CDD:238322 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4657
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2669
OMA 1 1.010 - - QHG59914
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004120
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103936
Panther 1 1.100 - - LDO PTHR10870
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.