DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad1 and RAD1

DIOPT Version :9

Sequence 1:NP_477440.1 Gene:Rad1 / 33440 FlyBaseID:FBgn0026778 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_002844.1 Gene:RAD1 / 5810 HGNCID:9806 Length:282 Species:Homo sapiens


Alignment Length:265 Identity:82/265 - (30%)
Similarity:153/265 - (57%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VARVEHIKTFIQAIKSICFNDYGMVQVSEDGLRITVEQGKSIQATLFMPPGAFMEFRVQDFQ-CF 78
            ||.:::::.....:|:|.|.::.....:::|:::|||..|.:||..|:..|.|.||:||:.. .|
Human    18 VASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTF 82

  Fly    79 GVKMNVLSECLSLFGSAD-----CSLRMMYRDKGDPLKIILYPHDDDDVSTECAIKTMDCDEPID 138
            .:.:.||.:|||:|||:.     .:|||.|:..|.||.:.|   ::..|.|.|.|.|.:.:|.:|
Human    83 RINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLMLFL---EEGGVVTVCKINTQEPEETLD 144

  Fly   139 YD---QNLKDPDLNVIFVRGPNLSKVFNELEKSAEEFEFVTSPNRPHFKITTVGIMQAVFS-VEV 199
            :|   .|:    :|.|.::...|.:.|:||:.::|..:...||::|:|:::|.|  .|..| ::.
Human   145 FDFCSTNV----INKIILQSEGLREAFSELDMTSEVLQITMSPDKPYFRLSTFG--NAGSSHLDY 203

  Fly   200 AKTSPMMMMFNCKQTVVARYKSQQIRMTNKAMQSATKVAIKTNSVGLLELHLVMQGDSQEEIFIQ 264
            .|.|.:|..|:|.||.|.|||...::.:.||:..:.||:|:|::.|.|.|..:::.:..:..|::
Human   204 PKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMIRNEDGQICFVE 268

  Fly   265 FFIIP 269
            ::..|
Human   269 YYCCP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad1NP_477440.1 PCNA 13..272 CDD:238322 82/265 (31%)
Rad1 13..253 CDD:280331 80/247 (32%)
RAD1NP_002844.1 Rad1 17..257 CDD:396631 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159570
Domainoid 1 1.000 134 1.000 Domainoid score I5034
eggNOG 1 0.900 - - E1_KOG3194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37695
Inparanoid 1 1.050 142 1.000 Inparanoid score I4475
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59914
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004120
OrthoInspector 1 1.000 - - oto88671
orthoMCL 1 0.900 - - OOG6_103936
Panther 1 1.100 - - LDO PTHR10870
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1057
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.