DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rad1 and Rad1

DIOPT Version :9

Sequence 1:NP_477440.1 Gene:Rad1 / 33440 FlyBaseID:FBgn0026778 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001099889.1 Gene:Rad1 / 294800 RGDID:1306496 Length:280 Species:Rattus norvegicus


Alignment Length:279 Identity:76/279 - (27%)
Similarity:153/279 - (54%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDVEPSPYGDCKFVARVEHIKTFIQAIKSICFNDYGMVQVSEDGLRITVEQGKSIQATLFMPPG 65
            :|......|.....||.:::::.....:|:|.|.::.....:::|:::|||..|.:||..|:...
  Rat     4 LTQYNEDEYEQYCLVASLDNVRNLSTVLKAIHFKEHATCFATKNGIKVTVENAKCVQANAFIQAD 68

  Fly    66 AFMEFRVQDFQ-CFGVKMNVLSECLSLFGSAD-----CSLRMMYRDKGDPLKIILYPHDDDDVST 124
            .|.||.:|:.. .|.:.:.:|.:|||:|||:.     .:|||.|:..|.||.:.|   ::..|.|
  Rat    69 VFQEFIIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLMLFL---EEGGVVT 130

  Fly   125 ECAIKTMDCDEPIDYD---QNLKDPDLNVIFVRGPNLSKVFNELEKSAEEFEFVTSPNRPHFKIT 186
            .|.|.|.:.::.:|:|   .|:    :|.|.::...|.:.|:||:.:.:..:...||::|:|:::
  Rat   131 VCKITTQEPEDTLDFDFCSTNV----MNKIILQSEGLREAFSELDMTGDVLQITVSPDKPYFRLS 191

  Fly   187 TVGIMQAVFS-VEVAKTSPMMMMFNCKQTVVARYKSQQIRMTNKAMQSATKVAIKTNSVGLLELH 250
            |.|  .|..| ::..|.|.::..|:|.:|.:.|||...::.:.||:..:.||:|:|::.|.|.|.
  Rat   192 TFG--NAGNSHLDYPKDSDLVEAFHCNKTQINRYKLSLLKPSTKALALSCKVSIRTDNRGFLSLQ 254

  Fly   251 LVMQGDSQEEIFIQFFIIP 269
            .:::.:..:..|::::..|
  Rat   255 YMIRNEDGQICFVEYYCCP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rad1NP_477440.1 PCNA 13..272 CDD:238322 74/267 (28%)
Rad1 13..253 CDD:280331 72/249 (29%)
Rad1NP_001099889.1 Rad1 17..257 CDD:396631 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353621
Domainoid 1 1.000 124 1.000 Domainoid score I5433
eggNOG 1 0.900 - - E1_KOG3194
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37695
Inparanoid 1 1.050 134 1.000 Inparanoid score I4497
OMA 1 1.010 - - QHG59914
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004120
OrthoInspector 1 1.000 - - oto95804
orthoMCL 1 0.900 - - OOG6_103936
Panther 1 1.100 - - LDO PTHR10870
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.