DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and CYP702A6

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:395 Identity:80/395 - (20%)
Similarity:161/395 - (40%) Gaps:85/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 KYAR--LNPFWASGQSWRRLRTDAQAGI-----SGSRLRQAYNIWEQGGQMLTEYMTQQV--AEK 206
            |:||  .|.|..|.....|:..|....:     .|:| :.:.:|.|...:::.|.:.::|  ..:
plant   126 KHARSLTNQFLGSQALKLRMLQDIDFLVRTHLKEGAR-KGSLDIKETTSKIIIECLAKKVMGEME 189

  Fly   207 NNILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAP 271
            .:..:...||:.:.......|.|.|....:.|.::..|:              |:.:...|:   
plant   190 PDAAKELTLCWTFFPREWFGFAWNIPGTGVYRMVKARNR--------------MMKVLKETV--- 237

  Fly   272 CSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQATHDDLVGHALT 336
                 |:.|...:|..:||..:          .||:.           |..|..:.:....:..|
plant   238 -----LKKRASGEELGDFFKTI----------FGDTE-----------RGVKTISLESATEYIFT 276

  Fly   337 VMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCM-----ASEKS-LDFEKLSSLQYLEQVI 395
            :.|...:|:...|...:..::::|.|.|:|:.|....:     .:||: |.:|...|:.:.:.||
plant   277 LFLLANETTPAVLAATIKLISDHPKVMQELQREHEGIVRDKIEKNEKADLTWEDYKSMTFTQMVI 341

  Fly   396 YESLRLSSLIPQYTKVCTLPTVIRLSESK----SLDVEVGMTIMIPNYQF-HHDKQYFPEPEAFK 455
            .||||::|         |:|||:|:.:.:    ...:..|...|  .|.: |.:.:.:.:|.||.
plant   342 NESLRITS---------TVPTVLRIIDHEFQFGEYTIPAGWIFM--GYPYVHFNAEKYDDPLAFN 395

  Fly   456 PERFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQ--------VVRGRDR 512
            |.|:.......::.: .::||..|.|:|:|.....|.: :..:|.||.::        ::|....
plant   396 PWRWKGKDLSAIVSR-TYIPFGSGSRLCVGAEFVKLKM-AIFIHHLSRYRWSMKTETTLLRRFVL 458

  Fly   513 LIPKG 517
            ::|:|
plant   459 ILPRG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 80/395 (20%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 77/384 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.