DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and CYP94B2

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_566155.1 Gene:CYP94B2 / 821263 AraportID:AT3G01900 Length:496 Species:Arabidopsis thaliana


Alignment Length:521 Identity:103/521 - (19%)
Similarity:179/521 - (34%) Gaps:127/521 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFDVQKIYDKYKGKHRAVGVF 109
            ||||.:.|.....|..:..|. .|.:...::|......|.::.|:       |.|.       ..
plant     9 LLVLVLLLVSAGKHVIYSCRN-STPKTYPVIGCLISFYTNRNRLL-------DWYT-------EL 58

  Fly   110 VTRQPQILVLDPELA--HEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFW------------- 159
            :|..|...|:...||  ..|:.:|      .....|:....:|.|.:..||.             
plant    59 LTESPSRTVVIRRLAARRTVVTAN------PSNVEYILKTNFDNYPKGKPFTEILGDFLGNGIFN 117

  Fly   160 ASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVM 224
            ..|..|.:.|..|....:...||:...:.....:..........||.:...:.::|..|:|.:::
plant   118 VDGNLWLKQRRLATHDFTPKSLREYVTVLRNEVEKELLAFLNAAAEDSQPFDLQELLRRFTFNIV 182

  Fly   225 ADFIWGIDAGTL--TRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSRLLLRFRFYPKETD 287
            .....|||..||  :.|:.:.::..:.||               .:.|......|.|.:..|...
plant   183 CIVFLGIDRCTLNPSSPVSEFDRAFQTAS---------------AVSAGRGSAPLSFVWKFKRLV 232

  Fly   288 EFFSNLTKESIELRLKAGD---------------STRTDYLSHLLQLRDQKQATHDDLVGHALTV 337
            .|.|..     |||...|:               ....|:||.|:...:..:...|.::    ::
plant   233 GFGSEK-----ELRKAVGEVHNCVDEIIRDKKRKPANQDFLSRLIVAGESDETVRDMVI----SI 288

  Fly   338 MLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEK---SLDFEKLSSLQYLEQVIYESL 399
            ::.|.||:........:.:..:...:..|..||.|  ..|:   ..|:|.|..|..|:..:.|.:
plant   289 IMAGRDTTSAVATRLFWLITGHEETEHDLVSEIRS--VKEEITGGFDYESLKKLSLLKACLCEVM 351

  Fly   400 RLSSLIPQYTKVC----TLP--TVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFP--------- 449
            ||...:|..:|..    .||  |::|..:..:                     |||         
plant   352 RLYPPVPWDSKHALTDDRLPDGTLVRAGDRVT---------------------YFPYGMGRMEEL 395

  Fly   450 ---EPEAFKPER----FDNGAYQELMRKGIF-LP-FSDGPRICMGVPLAMLTLKSALVHILSNFQ 505
               :.:.|||.|    :|....:.|.:...| .| |..|||:|:|..:|.:.:|..:..||..|:
plant   396 WGEDWDEFKPNRWAESYDKTCCRVLKKVNPFKFPVFQAGPRVCLGEEMAYVQMKYIVASILDRFE 460

  Fly   506 V 506
            :
plant   461 I 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 95/496 (19%)
CYP94B2NP_566155.1 CYP86A 65..483 CDD:410687 88/450 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.