DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:164 Identity:32/164 - (19%)
Similarity:69/164 - (42%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGIDAGTLTRP-- 239
            :..:|:..:.|.:..|.:|.:|:.|: |||...:..:|:...|:..|:....:|::..:|..|  
  Rat     3 TSGKLKVMFPIIKLYGDILVKYLRQE-AEKGKPVSVKDIFGAYSMDVITSTSFGVNVDSLNNPKD 66

  Fly   240 --MEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSRL---LLRFRFYPKETDEFFSNLTKESIE 299
              :|:..|...:.        |...||::..:.|..:.   :|....:||::..||.|......|
  Rat    67 PFVEKTKKFLRLD--------YFDPLFISVELFPFLKPIYDMLNISVFPKDSIAFFKNFVYSMKE 123

  Fly   300 LRLKAGDSTRTDYLSHLLQLRDQKQATHDDLVGH 333
            ..|.:....:.|:...::...:....:|....|:
  Rat   124 SHLDSKQKYQVDFFQLMMNAHNNSSESHKGKQGN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 32/164 (20%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.