DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and CYP4F12

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:438 Identity:101/438 - (23%)
Similarity:180/438 - (41%) Gaps:79/438 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 CYKDSLQS----SYLRHAKWDKYARLNPFW-------ASGQSWRRLRTDAQAGISGSRLRQAYNI 187
            |:.|:::|    |.....|.:.:.|....|       :.|..|.|.|.........:.|:....|
Human   102 CHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITI 166

  Fly   188 WEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMAS- 251
            :.:...::.:......:|.::.|:..:.....|...:...|:..|:....||.|....:.|::: 
Human   167 FNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSAL 231

  Fly   252 ---------KWTSYAFY-------------MLTLFMATIVAPCSRLLLRFRFYPKE-TDEFFSNL 293
                     :...:.:|             ::..|...::..      |.|..|.: .|:||.:.
Human   232 VEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRE------RRRTLPTQGIDDFFKDK 290

  Fly   294 TKESIELRLKAGDSTRTDYLSHLLQLRDQ--KQATHDDLVGHALTVMLDGYDTSGTALLHALYYL 356
            .|           |...|::..||..:|:  |..:.:|:...|.|.|..|:||:.:.|...||.|
Human   291 AK-----------SKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNL 344

  Fly   357 AENPAVQQKLRVEILSCMASE--KSLDFEKLSSLQYLEQVIYESLRLSSLIPQYTKVCTLPTVIR 419
            |.:|..|::.|.|:...:...  |.::::.|:.|.:|...:.|||||....|..::.||...|  
Human   345 ARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIV-- 407

  Fly   420 LSESKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAFKPERFD--NGAYQELMRKG----IFLPFSD 478
            |.:.:.  :..|:|.:|.....||:...:|:||.:.|.|||  |.       ||    .|:|||.
Human   408 LPDGRV--IPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENS-------KGRSPLAFIPFSA 463

  Fly   479 GPRICMGVPLAMLTLKSALVHILSNFQVV------RGRDRLIPKGDSG 520
            |||.|:|...||..:|..|..:|.:|:.:      |.:..||.:.:.|
Human   464 GPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGG 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 101/438 (23%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 99/431 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.