DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:514 Identity:124/514 - (24%)
Similarity:217/514 - (42%) Gaps:94/514 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ALILLHLLVLPIYLYLTWHH--KYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFDV--QKIYDKY 99
            :::|..::||..||.|.|..  .||:...:....|..|:|:..|:.|.:|   |..  ...|:|:
  Fly     5 SVLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTSRS---FSAIWMDYYNKF 66

  Fly   100 KGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFWASGQS 164
            :|.....|.:..::|.|||||..||..:|:..|..:.|  :..|  |...|.......|...||.
  Fly    67 RGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTD--RGFY--HNTEDDPLSGQLFLLDGQK 127

  Fly   165 WRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIW 229
            |:.:|:......:..:::..:....:.|....|...|.: ||:.|:|.||:..|:|..|:....:
  Fly   128 WKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAM-EKSPIVEVRDILARFTTDVIGTCAF 191

  Fly   230 GIDAGTLTRP------------MEQP---------NKVQEMASKWTSYAFYMLTLFMATIVAPCS 273
            ||:..:|..|            .||.         |..|.:|.:                     
  Fly   192 GIECSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARR--------------------- 235

  Fly   274 RLLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLR----------DQKQATHD 328
               |..:...:|.:.||..:.:|::..|.| .:..|.|::..|:.|:          :....|.:
  Fly   236 ---LHMKITLEEAEHFFLRIVRETVAFREK-NNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIE 296

  Fly   329 DLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMAS-EKSLDFEKLSSLQYLE 392
            ::...|......|::||.|.:..|||.||::..:|.::|.|....:.. ...:.:|.:..:.||:
  Fly   297 EMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGEITYESMKDMVYLD 361

  Fly   393 QVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEV----------GMTIMIPNYQFHHDKQY 447
            |||.|:|||.:::|...:.|.            .|.||          ||.::||....|.|::.
  Fly   362 QVISETLRLYTVLPVLNRECL------------EDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKL 414

  Fly   448 FPEPEAFKPERFDNGAYQELMRKGI-FLPFSDGPRICMGVPLAMLTLKSALVHILSNFQ 505
            :..|..|.|:.|.....:|  |..: :|||.||||.|:|:....:..:|.|..:::.|:
  Fly   415 YANPNTFNPDNFSPERVKE--RDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 115/481 (24%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 115/484 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460992
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.