DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp6a23

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster


Alignment Length:498 Identity:126/498 - (25%)
Similarity:236/498 - (47%) Gaps:41/498 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGT---YPGLLTRKSNLVFDVQKIYDK 98
            ||.|.|:.|||..:.......|.||::||:....|..:.|.   :|    :|.::....:..|.|
  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWP----KKRHIAMIFRDYYTK 62

  Fly    99 YKGKHRAV------GVFVTRQPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNP 157
            ||   |:|      ..|.||  ..::.|.||...||:.:|    :..::..:.:.:.|.......
  Fly    63 YK---RSVYPFAGFYFFFTR--SAVITDLELVKRVLIKDF----NHFENRGIFYNEIDDPLSATL 118

  Fly   158 FWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTE-YMTQQVAEKNNILETRDLCFRYTA 221
            |...||.||.||.......:..:::..:.|..:.|:.:.: :..:....:..:||..||..||||
  Fly   119 FSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTA 183

  Fly   222 HVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSRLLLRFRFYPKET 286
            .|:.:..:|::..:|..|..:...:.:.|.....|...:..|...   .|.....||.:...::.
  Fly   184 DVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFG---FPKLSRRLRLKLNVQDV 245

  Fly   287 DEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQA--THD-----DLVGHALTVMLDGYDT 344
            ::|::::.:.:|:.||:..:. |.|::..|:::.:::||  |.|     :::..|....:.|::|
  Fly   246 EDFYTSIVRNTIDYRLRTNEK-RHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFET 309

  Fly   345 SGTALLHALYYLAENPAVQQKLRVEILSCMASEKS-LDFEKLSSLQYLEQVIYESLRLSSLIPQY 408
            |.|.:..|||.||.:..:|.:||.||.:.::...: ..:|.:..::|||||:.|:||...::...
  Fly   310 SSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHL 374

  Fly   409 TKVCTLPTVIRLS-ESKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAFKPERFDNGAYQELMRKGI 472
            |::    |....| |.....:..|.|::||....|:|.:.:||||.||||||.:.|. .......
  Fly   375 TRM----TQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAI-AARPSCT 434

  Fly   473 FLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRDRLIP 515
            :|||.:|||.|:|:...::.....|.:::..::.....:..||
  Fly   435 WLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 114/465 (25%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 114/464 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460996
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.