DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:496 Identity:108/496 - (21%)
Similarity:216/496 - (43%) Gaps:55/496 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILASLALILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGTYPGLLTRKSNLVFDVQKIYDK 98
            :||::.|:|        :.:.|...|.:..|.|...:|...||.......:|::....:.:.|::
  Fly     9 VLATIGLLL--------FKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNR 65

  Fly    99 YKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNF--------------RCYKDSLQSSYLRHAKW 149
            .: .|:.||:|..|.|.|.:.||:|..::.|.:|              |...|.|  :.:|    
  Fly    66 TR-HHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDML--NVMR---- 123

  Fly   150 DKYARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYM--TQQVAEKNNI--L 210
                        .|.||.:|:......:.:::|..:.:..:......|::  :|.:|...|.  |
  Fly   124 ------------DQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFEL 176

  Fly   211 ETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPCSRL 275
            :.:.||.:.:..|:|...:|:...:...|..:.:.:.:..:......|..   ||..::||....
  Fly   177 DMKVLCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLK---FMMCLLAPKVFN 238

  Fly   276 LLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQLRDQKQA--THDDLVGHALTVM 338
            ..:...:.....|:|..|..::::.|.| .:.||.|.:..|::.:.:.:.  |.|::|.......
  Fly   239 FFKLTIFDSTNVEYFVRLVVDAMQYREK-HNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFIFF 302

  Fly   339 LDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKS--LDFEKLSSLQYLEQVIYESLRL 401
            ...::.:...:....|.|..|..:|::|..|:.....:.|.  |.::....:.|::.||.||||.
  Fly   303 FAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRK 367

  Fly   402 SSLIPQYTKVCTLPTVIRLSE-SKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAFKPERFDNGAYQ 465
            .:|.....::|.....:...| :|..:.:.|..|.||....|.|:::||:|:.|.||||.....:
  Fly   368 WTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKK 432

  Fly   466 ELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQV 506
            :|: ...:|||..|||.|:|...|::..|..|.:::.|:::
  Fly   433 DLI-PYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 100/460 (22%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 100/460 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460918
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.