DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:500 Identity:119/500 - (23%)
Similarity:198/500 - (39%) Gaps:80/500 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TLLGTYPGLLTRKSNLVFD-VQKIYDKYKGKHRAVGVFVTRQPQILVLDPELAHEVLVSNFRCYK 136
            |..|....|:...|..:|: ::....|.||::.....|  ..|...::..|.|.|:|.|:....|
  Fly    55 TRFGNNFDLVNFTSESIFNFMRDASAKAKGRNYLWYFF--HAPMYNIVRAEEAEEILQSSKLITK 117

  Fly   137 DSLQSSYLRHAKWDKYARLNPFWASG------QSWRRLRTDAQAGISGSRLRQAYNIWEQGGQML 195
            :.:            |..|.||...|      |.|...|...........|:....|:::....|
  Fly   118 NMI------------YELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKL 170

  Fly   196 TEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGIDAGTLT---RPMEQPNKVQE-MASKWTSY 256
            .:.:.|.|   |..||...:..::|.:.:.:...|:....|:   |..:..:.::| |..:..:.
  Fly   171 VKVLHQSV---NMELELNQVIPQFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNP 232

  Fly   257 AFYMLTLFMATIVAPCSRLLLRFRFYPKETD------EFFSNLTKESIELRLKA---------GD 306
            .||.:..|..            |..|.|:.:      ||.||:.::...| .|:         |.
  Fly   233 FFYNIVYFFL------------FGDYRKQVNNLKIAHEFSSNIIEKRRSL-FKSNQLGQEDEFGK 284

  Fly   307 STRTDYLSHLLQLRDQKQATHDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEIL 371
            ..|...|..||......|..|..:.....|.|.:||||:.|.|:..|..||.:..||:|...||.
  Fly   285 KQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIK 349

  Fly   372 SCMASEKSLDFEKLSSLQYLEQVIYESLRLSSLIPQYTKVCTLPTVIR-LSESKSLDVEVGMTIM 435
            ........:...:.:.|.|:|.||.|||||...:|...:.|....|:. |...|:..:.:.:   
  Fly   350 YLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHL--- 411

  Fly   436 IPNYQFHHDKQYFPEPEAFKPERF--DNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALV 498
               |:...|.::|..|:.|:|:||  :|...:...   .|:|||.|.|.|:|...|:|.:|..|.
  Fly   412 ---YEIMRDARHFSNPKMFQPDRFFPENTVNRHPF---AFVPFSAGQRNCIGQKFAILEIKVLLA 470

  Fly   499 HILSNFQVVRGRDRLIP---KGDSGF--GVVLQGDVNLEYRRFFR 538
            .::.||       :::|   ..|..|  |:||:...|::.:...|
  Fly   471 AVIRNF-------KILPVTLLDDLTFENGIVLRTKQNIKVKLVHR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 116/486 (24%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 117/493 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.