DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:427 Identity:106/427 - (24%)
Similarity:178/427 - (41%) Gaps:89/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFWASGQSWRRLRTDAQAGIS----G 178
            :|.|....::|.|..:.:..|:.:   .||||.:..      |.|.:    |.|....||    .
  Rat   151 LLTPAFHFDILKSYVKIFNKSVNT---MHAKWQRLT------AKGSA----RLDMFEHISLMTLD 202

  Fly   179 SRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQP 243
            |..:..::......:..:||:...:...:.|::.:...|.|     .||::     .||....:.
  Rat   203 SLQKCIFSFDSNCQESNSEYIAAILELSSLIVKRQRQPFLY-----LDFLY-----YLTADGRRF 257

  Fly   244 NKVQEMASKWTSYAFYMLTLFMATIVAPCSRLLLRFRFYPKETDEFFSNLTKESIELRLKAGDST 308
            .|..::...:|.                   .::|         |..|.|..:.::..|||...|
  Rat   258 RKACDVVHNFTD-------------------AVIR---------ERRSTLNTQGVDEFLKARAKT 294

  Fly   309 RT-DYLSHLLQLRDQ--KQATHDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEI 370
            :| |::..||..:|:  |..:..|:...|.|.|..|:||:.:||...||.||.:|..|::.|.|:
  Rat   295 KTLDFIDVLLLAKDEHGKGLSDVDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEV 359

  Fly   371 LSCMASE--KSLDFEKLSSLQYLEQVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEV--- 430
            ...:...  :.::::.|:.|.:|...|.|||||.            |.|:.:|...|.|:.:   
  Rat   360 RELLRDREPEEIEWDDLAQLPFLTMCIKESLRLH------------PPVLLISRCCSQDIVLPDG 412

  Fly   431 -----GMTIMIPNYQFHHDKQYFPEPEAFKPERFDNGAYQELMRKGI-FLPFSDGPRICMGVPLA 489
                 |...:|..:..||:...:|:||.:.|.|||....|:  |..: |:|||.|||.|:|...|
  Rat   413 RVIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQK--RSPLAFIPFSAGPRNCIGQTFA 475

  Fly   490 MLTLKSALVHILSNFQVV------RGRDRLIPKGDSG 520
            |..:|.||...|..|.|:      |.:..||.:.:.|
  Rat   476 MSEIKVALALTLLRFCVLPDDKEPRRKPELILRAEGG 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 106/427 (25%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 106/427 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.