DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp3a23-3a1

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_037237.2 Gene:Cyp3a23-3a1 / 25642 RGDID:628626 Length:502 Species:Rattus norvegicus


Alignment Length:525 Identity:140/525 - (26%)
Similarity:243/525 - (46%) Gaps:93/525 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MYILASLAL---ILLHLLVLPIYLYLTWHHKYWRKRGLVTARPLTLLGT----YPGLLTRKSNLV 89
            |.:|::|.|   :||.::::.:|.:.|..|..::|:|:...:||...||    |.||..      
  Rat     1 MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWK------ 59

  Fly    90 FDVQKIYDKYKGKHRAVGVFVTRQPQILVLDPELAHEVLV----SNFRCYKD-------SLQSSY 143
            |||: .:.|| ||  ..|:|..:.|...:.|.|:...|||    |.|...:|       ....|.
  Rat    60 FDVE-CHKKY-GK--IWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISV 120

  Fly   144 LRHAKWDKY-ARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKN 207
            .:..:|.:| |.|:|.:.||                 ||::.:.:.||.|.:|.:|:.|   ||.
  Rat   121 SKDEEWKRYRALLSPTFTSG-----------------RLKEMFPVIEQYGDILVKYLRQ---EKG 165

  Fly   208 NILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMASKWTSYAFYMLTLFMATIVAPC 272
            ..:..:::...|:..|:....:|::..:|..|.:   ...|.|.|.....|:. .||::.::.|.
  Rat   166 KPVPVKEVFGAYSMDVITSTSFGVNVDSLNNPKD---PFVEKAKKLLRIDFFD-PLFLSVVLFPF 226

  Fly   273 SR---LLLRFRFYPKETDEFFSNLTKESIELRLKAGDSTRTDYLSHLLQL------RDQKQATHD 328
            ..   .:|....:||::.|||........|.||.:....|.|:|..::..      ::...|..|
  Rat   227 LTPVYEMLNICMFPKDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSD 291

  Fly   329 -DLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLE 392
             ::...::..:..||:.:.:.|...|:.||.:|..|:||:.||...:.::....::.:..::||:
  Rat   292 MEITAQSIIFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLD 356

  Fly   393 QVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEV-------GMTIMIPNYQFHHDKQYFPE 450
            .|:.|:|||..:..:..:||            ..|||:       |..:|||:|..|.|.|::||
  Rat   357 MVLNETLRLYPIGNRLERVC------------KKDVEINGVFMPKGSVVMIPSYALHRDPQHWPE 409

  Fly   451 PEAFKPERFDNGAYQELMRKG-----IFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGR 510
            ||.|:||||..      ..||     ::|||.:|||.|:|:..|::.:|.||..:|.||.....:
  Rat   410 PEEFRPERFSK------ENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCK 468

  Fly   511 DRLIP 515
            :..||
  Rat   469 ETQIP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 129/484 (27%)
Cyp3a23-3a1NP_037237.2 p450 39..492 CDD:278495 129/487 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.