DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and erg5

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:446 Identity:89/446 - (19%)
Similarity:169/446 - (37%) Gaps:113/446 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YDKYKGKHR-----AVGVFVTRQPQILVLDPELAHEVLVSNF---RCYKDSLQSSYLRHAKWDKY 152
            ::||..|.:     .|.||  .:..::..:.:||.::|.|..   .|..|: ....|:|..|   
pombe    75 FEKYNAKWQTGPLSCVSVF--HKFVVIASERDLARKILNSPSYVQPCVVDA-GKKILKHTNW--- 133

  Fly   153 ARLNPFWASGQSWRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCF 217
                 .:..|    |...:.:.|::|....:|          |..|:..|.|..|...:      
pombe   134 -----VFLDG----RDHIEYRKGLNGLFTTRA----------LASYLPAQEAVYNKYFK------ 173

  Fly   218 RYTAHVMADF------IWGIDAGTLTRPM----EQPNKVQEMASK-WTSYAFYMLTLFMATIVAP 271
            .:.||...|:      ...|:..|..|..    ...:.::.:|.: |...|...|..|  .||.|
pombe   174 EFLAHSKDDYAQYMIPFRDINVATSCRTFCGYYISDDAIKHIADEYWKITAAMELVNF--PIVLP 236

  Fly   272 CSRL-------LLRFRFYPKETDEFFSNLTKESIELRLKAGDS---TRTDYLSHLLQLRDQK--- 323
            .:::       .:..|::.|...|...|         ::||::   ...:::..:::.|..|   
pombe   237 FTKVWYGIQSRKVVMRYFMKAAAESRKN---------MEAGNAPACMMEEWIHEMIETRKYKSEN 292

  Fly   324 ------------QATHDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMAS 376
                        :.:.:::....|:.:....|.:.:|:......||::|.|.||:|.|.|.....
pombe   293 KEGAEKPSVLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQLRIRKG 357

  Fly   377 --EKSLDFEKLSSLQYLEQVIYESLRLSS---LIPQYTKVCTLPTVIRLSESKSLDVEVGMTI-- 434
              :..|..:.:..:.|...|:.|.|||..   ::|...|             |:..:....|:  
pombe   358 DIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVK-------------KAFPITPDYTVPK 409

  Fly   435 ---MIPN-YQFHHDKQYFPEPEAFKPERF-DNGAYQELMRKGIFLPFSDGPRICMG 485
               :||. |...||.:.:||||.|.|:|: .||..::..:.  ::.|.:||.:|:|
pombe   410 DAMVIPTLYGALHDSKVYPEPETFNPDRWAPNGLAEQSPKN--WMVFGNGPHVCLG 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 89/446 (20%)
erg5NP_593788.2 CypX 57..505 CDD:225035 89/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.