DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:523 Identity:114/523 - (21%)
Similarity:198/523 - (37%) Gaps:121/523 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ALILLHLLVLPIYLYLTWHHK-------------YW--------RKRGLVT-----------ARP 71
            ::::|.::||.::..|....|             :|        :|.|.:.           |.|
  Rat    18 SVVILMVIVLKLFSLLLRRQKLARAMDSFPGPPTHWLFGHALEIQKLGSLDKVVSWAQQFPHAHP 82

  Fly    72 LTLLGTYPGLL------------TRKSNLVFDVQKIYDKYKGKHRAVGVFVTRQPQIL----VLD 120
            | ..|.:.|.|            :|......||...:.::.||    |:.|...|:..    :|.
  Rat    83 L-WFGQFVGFLNIYEPDYAKAVYSRGDPKAADVYDFFLQWIGK----GLLVLDGPKWFQHRKLLT 142

  Fly   121 PELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLNPFWASGQSWRRLRTDAQAGISGSRLRQAY 185
            |...::||......:.:|.:   :...||:|.|..|                          :::
  Rat   143 PGFHYDVLKPYVAIFAESTR---MMLDKWEKKASEN--------------------------KSF 178

  Fly   186 NIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYTAHVMADFIWGIDAGTLTRPMEQPNKVQEMA 250
            :|:...|.|..:.:.:....|.:    ..|..|..::.:|       ...||..|:|        
  Rat   179 DIFCDVGHMALDTLMKCTFGKGD----SGLGHRDNSYYLA-------VSDLTLLMQQ-------- 224

  Fly   251 SKWTSYAFYMLTLFMATIVAPCSRLLLR-FRFYPKETDEFFSNLTKESIE---LRLKAGDSTRTD 311
             :..|:.::...::..|   |..|..|| .:.....|||.... .|.:::   .|.|.......|
  Rat   225 -RIDSFQYHNDFIYWLT---PHGRRFLRACKIAHDHTDEVIRQ-RKAALQDEKERKKIQQRRHLD 284

  Fly   312 YLSHLLQLRDQK--QATHDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCM 374
            :|..||.:||:.  :.:..:|.....|.|.:|:||:.:.:...||.:|..|..||..|.|:...:
  Rat   285 FLDILLGVRDESGIKLSDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGIL 349

  Fly   375 ASEKSLDFEKLSSLQYLEQVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNY 439
            ..:.|..::.|:.:.||...:.|..||...:||..:....|  :...:.:||  ..|..|.:..|
  Rat   350 GDQDSFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQLNKP--VTFVDGRSL--PAGSLISLHIY 410

  Fly   440 QFHHDKQYFPEPEAFKPERF--DNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTLKSALVHILS 502
            ..|.:...:|:||.|.|.||  :|.|.:...   .|:|||.|||.|:|...||..:|......|.
  Rat   411 ALHRNSTVWPDPEVFDPLRFSPENAAGRHPF---AFMPFSAGPRNCIGQQFAMNEMKVVTALCLL 472

  Fly   503 NFQ 505
            .|:
  Rat   473 RFE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 105/460 (23%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 109/494 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.