DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and cest-32

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:213 Identity:51/213 - (23%)
Similarity:72/213 - (33%) Gaps:64/213 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 HDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYL 391
            |.:.:.|....|      ||:|.........|..|       ||....|.....:.|...||  |
 Worm   223 HSNKLFHRFMAM------SGSAFCEFSIRTKEQEA-------EIFRNFAKHHGYEGEDSESL--L 272

  Fly   392 EQVIYESLRLSSLIPQYTKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFHHDKQYFPEPEAFKP 456
            |.  |:|..||    ::.:..|.       |.|:    .|....|||:    |..:||:|     
 Worm   273 EW--YKSQPLS----KFQETATF-------EKKA----SGFLTFIPNF----DGDFFPKP----- 311

  Fly   457 ERFDNGAYQELMRKGIFLPFSDGPRICMGVPLAMLTL-KSALVHILSNFQVVRGRDRLIPKGDSG 520
                   :.||.|        :.|::.     ||.|: :...:..|:.|| .|..|..|.|...|
 Worm   312 -------FDELSR--------EAPKLD-----AMATVDEYEGLGFLTMFQ-SRRNDMDIIKSSFG 355

  Fly   521 FGVVLQG-DVNLEYRRFF 537
            ..||... ||......|:
 Worm   356 SDVVENAVDVQKRIMEFY 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 48/199 (24%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 51/213 (24%)
Aes <104..>227 CDD:223730 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.