DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001335100.1 Gene:Cyp19a1 / 13075 MGIID:88587 Length:503 Species:Mus musculus


Alignment Length:376 Identity:87/376 - (23%)
Similarity:148/376 - (39%) Gaps:67/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 WRRLRTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVAEKNNILETRDLCFRYT--AHVMAD- 226
            ||.:|......::|..|.:..       ::..|.:.|.:.....:.:|.......|  .|:|.| 
Mouse   141 WRTIRPFFMKALTGPGLVRMV-------EVCVESIKQHLDRLGEVTDTSGYVDVLTLMRHIMLDT 198

  Fly   227 ---FIWGIDAGTLTRPMEQP---NKVQEMASKWTSYAFYMLTLFMATIVAPCSRLLLRFRFYPKE 285
               ...||       |:::.   .|:|...:.|           .|.::.|  .:..:..:..::
Mouse   199 SNMLFLGI-------PLDESAIVKKIQGYFNAW-----------QALLIKP--NIFFKISWLYRK 243

  Fly   286 TDEFFSNLTKESIELRLKAGDSTRT--------DYLSHLLQLRDQKQATHDDLVGHALTVMLDGY 342
            .:....:|..|...|..|......|        |:.:.|:....:...|.:::....|.:::...
Mouse   244 YERSVKDLKDEIAVLVEKKRHKVSTAEKLEDCMDFATDLIFAERRGDLTKENVNQCILEMLIAAP 308

  Fly   343 DTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFEKLSSLQYLEQVIYESLRLSSLIPQ 407
            ||....|...|..:||.|.|:..:..|| ..:..::.:..|.:.:|:.:|..|.||:|       
Mouse   309 DTMSVTLYFMLLLVAEYPEVEAAILKEI-HTVVGDRDIKIEDIQNLKVVENFINESMR------- 365

  Fly   408 YTKVCTLPTVIRLSESKSLD---VEVGMTIMIPNYQFHHDKQYFPEPEAFKPERFD-NGAYQELM 468
            |..|..| .:.|..|...:|   |:.|..|:: |....|..:|||:|..|..|.|: |..|:   
Mouse   366 YQPVVDL-VMRRALEDDVIDGYPVKKGTNIIL-NIGRMHRLEYFPKPNEFTLENFEKNVPYR--- 425

  Fly   469 RKGIFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQVVRGRDRL---IPK 516
               .|.||..|||.|.|..:||:.:|..||.:|..|||...:.|.   |||
Mouse   426 ---YFQPFGFGPRGCAGKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENIPK 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 87/376 (23%)
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 87/376 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.