DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a2 and tbxas1

DIOPT Version :9

Sequence 1:NP_608689.2 Gene:Cyp309a2 / 33439 FlyBaseID:FBgn0041337 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_031753608.1 Gene:tbxas1 / 100327243 XenbaseID:XB-GENE-994325 Length:532 Species:Xenopus tropicalis


Alignment Length:520 Identity:123/520 - (23%)
Similarity:212/520 - (40%) Gaps:113/520 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LTWH--HKYWR--KRGLVTARPLTLLGTYPGLLTRKSNLVFD--VQKIYDKYKGKHRAVGVFVTR 112
            |.|:  ..:|:  |.|:...:||..:|..  :|.:|.....|  :.|.|..      ..|.::.|
 Frog    26 LYWYSVSAFWQLEKAGIKHPKPLPFIGNI--MLFQKGFWEGDRHLLKTYGP------ICGYYMGR 82

  Fly   113 QPQILVLDPELAHEVLVSNFRCYKDSLQSSYLRHAKWDKYARLN----PFWAS-----GQSWRRL 168
            :|.|::.:|:...:||..:|..:.:.:|             |||    |...|     ...|:|:
 Frog    83 RPMIVIAEPDAIKQVLQKDFVNFTNRMQ-------------RLNLVTKPMSDSLLCLRDDKWKRV 134

  Fly   169 RTDAQAGISGSRLRQAYNIWEQGGQMLTEYMTQQVA--EKNNILETRDLCFR-YTAHVMADFIWG 230
            |:......|.:|:::...:..|...:|.|.:.:..:  |..|:    ..|:. :|..|:|...:|
 Frog   135 RSVLTPSFSAARMKEMCPLINQCCDVLVENLMEYASSGEACNV----QRCYACFTMDVVASVAFG 195

  Fly   231 IDAGTLTRPMEQP--NKVQEMASKWTSY-AFYMLTLFMATIVAPCSRLLLRFRFYPKETD---EF 289
            ....: .|..:.|  ...:.....:|.: ...:|.|...:|:.|.:|     |...|..|   .|
 Frog   196 TQVDS-QRDSDHPLVQNCKRFLELFTPFKPVVLLCLAFPSIMIPIAR-----RLPNKHRDRINSF 254

  Fly   290 FSNLTKESIELR-LKAGDSTRTDYLSHLLQLRD-------------------------------- 321
            |..:.::.|..| .:..:..|.|:|..:|..||                                
 Frog   255 FLKVIRDIIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVNQADLSVPQNQDRGQDPPR 319

  Fly   322 ---QKQATHDDLVGHALTVMLDGYDTSGTALLHALYYLAENPAVQQKLRVEILSCMASEKSLDFE 383
               ||....::::|.|...::.||:|:.:.|..|.|.||.:|..|:||..|:.......:..|:.
 Frog   320 KSTQKTLNEEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEKLLKEVDEFSQEHEEADYN 384

  Fly   384 KLSSLQYLEQVIYESLRLSSLIPQY------TKVCTLPTVIRLSESKSLDVEVGMTIMIPNYQFH 442
            .:..|.|:|.||.|:||:..  |.|      .:.||:         ..|.:..|..:.||.....
 Frog   385 TVHDLPYMEMVINETLRMYP--PAYRFAREAARDCTV---------MGLGIPAGAVVEIPIGCLQ 438

  Fly   443 HDKQYFPEPEAFKPERFDNGAYQELMRKG--IFLPFSDGPRICMGVPLAMLTLKSALVHILSNFQ 505
            :|.:::.|||.|.||||   ..:|..::.  :||||..|||.|:|:.||:|..|..|..:|..|:
 Frog   439 NDPRFWHEPEKFNPERF---TAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITLYRVLRKFR 500

  Fly   506  505
             Frog   501  500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a2NP_608689.2 p450 70..526 CDD:299894 118/500 (24%)
tbxas1XP_031753608.1 cytochrome_P450 71..526 CDD:425388 111/473 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.