DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and CYP71A27

DIOPT Version :9

Sequence 1:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:469 Identity:94/469 - (20%)
Similarity:173/469 - (36%) Gaps:105/469 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEP--------LTILGSYPGILINKSRSLIL 60
            |:.||||.:     :.:.:|    |...|| :.|.:|        |.::|:...:..|..|.|  
plant     5 LISLCLTTL-----LAFLFL----KPLLKR-ITTTKPKLPPSPWRLPVIGNLHQLGPNPHRYL-- 57

  Fly    61 DVQDVYNKYKDKYRTVGTFIT----RQPQLLVLDPALAHEILVD---KFSHFRDTITSSFVGHNP 118
                  :....:|   |..:.    |.|.|:|..|.:.::|:..   ||:            :.|
plant    58 ------HSLSLRY---GPLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFA------------NRP 101

  Fly   119 DDK----YVAGSP---FFSAGDKWKRLRSENVGGLTPSRLKMAY-SIWEQSGRKLVEYIERARRE 175
            ..|    ::.|..   |...|:.||.::|..|..|..:::..:: ::.|:..:.:.|.:|.|...
plant   102 KSKAINIFMEGGRDIIFGPYGEDWKSMKSLGVVHLLNNKMVRSFENLREEEIKVMTEKLEEASSS 166

  Fly   176 QGDI-------IETRDLAYRFT-ANAMADFIWGIDAGSLSGKVGE------IGDFQKTST--DWS 224
            ...:       ..|.|:..|.| .....:...|||..:|.....|      .|||..:..  ||.
plant   167 SSSVNLSKLLMTLTNDIICRITLGRKYNEEEGGIDIKNLVMTSSEFFGKFFFGDFIPSLAWIDWI 231

  Fly   225 AHAFSSMIRFNKTLVAIFVRKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQL 289
            :.....|...|..|                  |.|...:.|:.|:    ...:..:|::..|:.:
plant   232 SGIDDKMKDINNKL------------------DCFLDSMVQEHVD----ADHKEPSDFIDMLLLI 274

  Fly   290 QQRGN-----SIHDSVGHALTVHLDGFETSGAVLYHMLYSLSEHHEEQEKLRSEILEALASEGQI 349
            |:...     ...|.:.....:...|..|:.:.|...:..|..|.|..:||:.||.........:
plant   275 QKDKTKRFKFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECMKKLQDEINSFSTHNLNV 339

  Fly   350 SYDQINNLPYLDQCFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDN 414
            :..::..:.||.....|.|||........|:.::..|:     |..|:..|..|::.|:....:.
plant   340 TEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQL-----KGYDISAGTHVIINAWALQRNP 399

  Fly   415 DIYP-EASEFRPDR 427
            .|:. :|:|:||:|
plant   400 AIWGLDANEYRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 81/416 (19%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 83/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.