DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:158 Identity:27/158 - (17%)
Similarity:62/158 - (39%) Gaps:16/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TPSRLKMAYSIWEQSGRKLVEYIERARREQGDIIETRDLAYRFTANAMADFIWGIDAGSLSGKVG 211
            |..:||:.:.|.:..|..||:|: |...|:|..:..:|:...::.:.:....:|::..||:....
  Rat     3 TSGKLKVMFPIIKLYGDILVKYL-RQEAEKGKPVSVKDIFGAYSMDVITSTSFGVNVDSLNNPKD 66

  Fly   212 EIGDFQKTSTDWSAHAFSSMIRFNKTLVAI----FVRKLFSM---RFFTKATDEFFLRLTQDAVN 269
            ..  .:||.      .|..:..|:...:::    |::.::.|   ..|.|.:..||.........
  Rat    67 PF--VEKTK------KFLRLDYFDPLFISVELFPFLKPIYDMLNISVFPKDSIAFFKNFVYSMKE 123

  Fly   270 LRQGGSGEGRTDYLSHLIQLQQRGNSIH 297
            .......:.:.|:...::......:..|
  Rat   124 SHLDSKQKYQVDFFQLMMNAHNNSSESH 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 27/158 (17%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 27/158 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.