DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:525 Identity:144/525 - (27%)
Similarity:252/525 - (48%) Gaps:81/525 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFT--LVGLCLTIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILGSYPGIL-------INKSR 56
            :||  |||:.|.:.:.....::       .||.::||....||.|:|:..||:       ||   
  Fly     2 LFTIALVGVVLGLAYSLHIKIF-------SYWKRKGVPHETPLPIVGNMRGIVKKYHFRDIN--- 56

  Fly    57 SLILDVQDVYNKYKDKYRTVGTFITRQPQLLVLDPALAHEILVDKFSHFRDTITSSFVGHNPDDK 121
                  |.:|.|:|.:....|.::..:...|:.|.....::::..||:|:|  ..:|.  ||.|.
  Fly    57 ------QRIYKKFKGQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQD--RGAFT--NPRDD 111

  Fly   122 YVAGSPFFSAGDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIER----ARREQGDIIET 182
            .:.|..|...|::|:.:|.:.....|..::|....:....|.:|.:.:::    |:.|:|: :|.
  Fly   112 PLTGHLFALEGEEWRAMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGN-VEI 175

  Fly   183 RDLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTLVAIFV---- 243
            :||..|||.:.:....:|::..||.....|   |::...:    .|:.  |.:.|||..|:    
  Fly   176 KDLCARFTTDVIGSCAFGLECNSLQDPSAE---FRQKGRE----IFTR--RRHSTLVQSFIFTNA 231

  Fly   244 ---RKLFSMRFFTKATDEFFLRLTQDAVNLRQGGSGEGRTDYLSHLIQLQ-------QRGNSIHD 298
               ||| .::.......:||:...::.|:.|. .:|..|.|::..:|:|:       ::|..|  
  Fly   232 RLARKL-RIKVLPDDLTQFFMSTVKNTVDYRL-KNGIKRNDFIEQMIELRAEDQEAAKKGQGI-- 292

  Fly   299 SVGHALTVH----------LDGFETSGAVLYHMLYSLSEHHEEQEKLRSEILEALAS--EGQISY 351
            .:.|.||:.          :.|||||.:.:...||.|:...:.|::||.||...||:  .|:::|
  Fly   293 DLSHGLTLEQMAAQAFVFFVAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNY 357

  Fly   352 DQINNLPYLDQCFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVTVMVPAYQYHHDNDI 416
            |.:..:.||||..:|:||....:...:|..||..||...|   :.|:.|:..::|.:..|||.:|
  Fly   358 DVLAQMTYLDQVLSETLRKHPLLPHLIRETTKDYQIPNSD---IVLDKGILALIPVHNIHHDPEI 419

  Fly   417 YPEASEFRPDRFENGAASVLTKRG-CFLPFGDGPRICLGMRVGQLSVKTAIVHILSNYQ--VEQM 478
            |||..:|.|.||:  ...|..:.. .:||||||||.|:|:|.|::..|..:|.:|..::  |...
  Fly   420 YPEPEKFDPSRFD--PEEVKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNR 482

  Fly   479 KKVPL 483
            ..|||
  Fly   483 TDVPL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 127/471 (27%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 134/488 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.