DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp309a1 and cyp3c1

DIOPT Version :9

Sequence 1:NP_001259943.1 Gene:Cyp309a1 / 33438 FlyBaseID:FBgn0031432 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_997838.1 Gene:cyp3c1 / 324340 ZFINID:ZDB-GENE-030131-3060 Length:505 Species:Danio rerio


Alignment Length:530 Identity:135/530 - (25%)
Similarity:229/530 - (43%) Gaps:99/530 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTLVGLCL--TIVHVAFAVVYFYLTWYHKYWDKRGVVTAEPLTILG---SYPGILINKSRSLIL 60
            ||.|..|.:  |:|.:...::..|..|.|.::.|.|:....||..:|   ||...:.|      .
Zfish     1 MFDLSSLSVTWTLVVLVITLLLIYGVWPHGFFKKLGIPGPRPLPFVGTALSYSKGICN------F 59

  Fly    61 DVQDVYNKYKDKYRTV-GTFITRQPQLLVLDPALAHEILV-DKFSHFRDTITSSFVGHNPDDKYV 123
            |::     ...||..| |.:..|.|.|||.|..:...||| |.:|.|.:....     |||   :
Zfish    60 DIE-----CSKKYGKVWGIYDGRLPLLLVTDLEMIKTILVKDCYSTFTNRRNM-----NPD---L 111

  Fly   124 AGSPFFSA-----GDKWKRLRSENVGGLTPSRLKMAYSIWEQSGRKLVEYIERARREQGDIIETR 183
            .| ||...     .::|:|:||......|..|||..:.|......:.::.:|  :::....::.:
Zfish   112 VG-PFADGITLVKDERWRRIRSSLSPYFTSGRLKEIFPIAMTHADRFIKNME--KKDPNLPLKIK 173

  Fly   184 DLAYRFTANAMADFIWGIDAGSLSGKVGEIGDFQKTSTDWSAHAFSSMIRFNKTLVAIFVRKLF- 247
            |:...::.:.:|...:.:|..|::           ...|....:..|....| .|..:|:...| 
Zfish   174 DVVAPYSLDVVASSSFSVDFDSIN-----------NPDDPFVTSIKSFFNIN-PLSPLFLLLAFC 226

  Fly   248 ----------SMRFFTKATDEFF---LRLTQDAVNLRQGGSGEGRTDYLSHLIQLQQRGNSIHDS 299
                      .:..|:::|.:|:   ||..:|..|     ...||.|:|..:||.|...:.:.|:
Zfish   227 PSAANLLAKMGISVFSRSTTDFYYKALRKIKDEHN-----ESNGRVDFLKLMIQNQIPDDQVKDT 286

  Fly   300 VGH----ALTVH----------LDGFETSGAVLYHMLYSLSEHHEEQEKLRSEILEALASEGQIS 350
            ...    .||.|          |.|:||:...|.::||:|:.:.:..|||..||.:....:..|:
Zfish   287 ASEQPVKGLTDHEILSQSFIFILGGYETTSTTLSYLLYNLATNPDCLEKLVEEIDKNFPLDIPIT 351

  Fly   351 YDQINNLPYLDQCFNESLRLTTPIGFFMRICTKPTQINLGDDKTLDLEPGVT------VMVPAYQ 409
            ||.:..:.||:...:||:|:........|:|.|..:||           |:|      |.:|.|.
Zfish   352 YDALMRMDYLEMAIHESMRVFPAGPRLERVCKKTVEIN-----------GITIPKNTLVGIPLYV 405

  Fly   410 YHHDNDIYPEASEFRPDRFENGAASVLTKRGC-FLPFGDGPRICLGMRVGQLSVKTAIVHILSNY 473
            ...|.|::...:||:|:||...:.:.:.:  | |:|||.|||.|:|||...:.:|..:|.:|..|
Zfish   406 LSRDPDLWESPNEFKPERFSPESKTEINQ--CAFMPFGLGPRNCIGMRFALMMMKLLVVKLLQKY 468

  Fly   474 QVEQMKKVPL 483
            .||..|:..:
Zfish   469 TVETCKETQI 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp309a1NP_001259943.1 p450 49..481 CDD:299894 119/473 (25%)
cyp3c1NP_997838.1 p450 38..496 CDD:278495 124/493 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.